Home » NRAMP1/SLC11A1 » NRAMP1 Peptides and Proteins » Recombinant Human NRAMP1/SLC11A1 GST (N-Term) Protein

Recombinant Human NRAMP1/SLC11A1 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals offers 100% Guarantee

Recombinant Human NRAMP1/SLC11A1 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-178 of Human SLC11A1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
SLC11A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
45.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NRAMP1/SLC11A1 GST (N-Term) Protein

  • natural resistance-associated macrophage protein 1
  • LSH
  • member 1
  • NRAMP 1
  • NRAMP1
  • NRAMP1solute carrier family 11 (sodium/phosphate symporters), member 1
  • NRAMPnatural resistance-associated macrophage protein 1
  • SLC11A1
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin NRAMP2/SLC11A2/DMT1 Antibody (4C6)
Immunohistochemistry NRAMP2/SLC11A2/DMT1 Antibody (4C6)
Immunohistochemistry NRAMP2/SLC11A2/DMT1 Antibody (4C6)
(9 Publications)
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
FABP6 Antibody
[Unconjugated]
AF3880
Immunocytochemistry FABP6 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunohistochemistry-Paraffin Integrin beta 3/CD61 Antibody (SJ19-09)
(2 Reviews)
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Integrin alpha
2b/CD41 Antibody (745 ...
MAB7616
Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
INT4 Antibody
NB100-60660
Western Blot INT4 Antibody
Immunohistochemistry-Paraffin INT4 Antibody
Immunohistochemistry-Paraffin INT4 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Wnt3 Antibody
(OTI1G7)
NBP2-46367
Immunohistochemistry Wnt3 Antibody (OTI1G7)
Immunohistochemistry Wnt3 Antibody (OTI1G7)
Immunohistochemistry Wnt3 Antibody (OTI1G7)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(141 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(458 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(304 Publications)
Species: Mu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CHMP2B Antibody
(791521) [Unconjugate
MAB7509
Western Blot CHMP2B Antibody (791521) [Unconjugated]
Immunohistochemistry CHMP2B Antibody (791521) [Unconjugated]
Knockout Validated CHMP2B Antibody (791521) [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, KO, WB
DMRT1 Antibody
NBP1-84071
Western Blot DMRT1 Antibody
Immunohistochemistry-Paraffin DMRT1 Antibody
Immunohistochemistry-Paraffin DMRT1 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(145 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/ Immunofluorescence ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
NRAMP1/SLC11A1 GST (N ...
H00006556-P01
Recombinant Human NRAMP1/SLC11A1 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for NRAMP1/SLC11A1 Recombinant Protein (H00006556-P01) (0)

There are no publications for NRAMP1/SLC11A1 Recombinant Protein (H00006556-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAMP1/SLC11A1 Recombinant Protein (H00006556-P01) (0)

There are no reviews for NRAMP1/SLC11A1 Recombinant Protein (H00006556-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRAMP1/SLC11A1 Recombinant Protein (H00006556-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NRAMP1/SLC11A1 Products

Blogs on NRAMP1/SLC11A1

There are no specific blogs for NRAMP1/SLC11A1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NRAMP1/SLC11A1 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC11A1