Home » NRAMP1/SLC11A1 » NRAMP1 Peptides and Proteins » NRAMP1/SLC11A1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NRAMP1/SLC11A1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NRAMP1/SLC11A1 Recombinant Protein Antigen (NBP3-17904PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

NRAMP1/SLC11A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRAMP1/SLC11A1

Source: E. coli

Amino Acid Sequence: FGQAFYQKTNQAAFNICANSSLHDYAKIFPMNNATVAVDI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC11A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17904.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NRAMP1/SLC11A1 Recombinant Protein Antigen

  • natural resistance-associated macrophage protein 1
  • LSH
  • member 1
  • NRAMP 1
  • NRAMP1
  • NRAMP1solute carrier family 11 (sodium/phosphate symporters), member 1
  • NRAMPnatural resistance-associated macrophage protein 1
  • SLC11A1
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

"This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin NRAMP2/SLC11A2/DMT1 Antibody (4C6)
Immunohistochemistry-Paraffin NRAMP2/SLC11A2/DMT1 Antibody (4C6)
ELISA NRAMP2/SLC11A2/DMT1 Antibody (4C6)
(9 Publications)
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
FABP6 Antibody
[Unconjugated]
AF3880
Immunocytochemistry FABP6 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Integrin beta
3/CD61 Antibody (SJ19
NBP2-67416
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunocytochemistry/ Immunofluorescence Integrin beta 3/CD61 Antibody (SJ19-09)
Immunohistochemistry-Paraffin Integrin beta 3/CD61 Antibody (SJ19-09)
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Integrin alpha
2b/CD41 Antibody (745 ...
MAB7616
Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]
(6 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
INT4 Antibody
NB100-60660
Western Blot INT4 Antibody
Immunohistochemistry-Paraffin INT4 Antibody
Immunohistochemistry-Paraffin INT4 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Wnt3 Antibody
(OTI1G7)
NBP2-46367
Immunohistochemistry Wnt3 Antibody (OTI1G7)
Immunohistochemistry Wnt3 Antibody (OTI1G7)
Immunohistochemistry Wnt3 Antibody (OTI1G7)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(121 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(445 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(287 Publications)
Species: Mu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
CHMP2B Antibody
(791521) [Unconjugate
MAB7509
Western Blot CHMP2B Antibody (791521) [Unconjugated]
Immunohistochemistry CHMP2B Antibody (791521) [Unconjugated]
Knockout Validated CHMP2B Antibody (791521) [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, WB
DMRT1 Antibody
NBP1-84071
Western Blot DMRT1 Antibody
Immunohistochemistry-Paraffin DMRT1 Antibody
Immunohistochemistry-Paraffin DMRT1 Antibody
(4 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(138 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
ISYNA1 Antibody
NBP2-47415
Immunocytochemistry/ Immunofluorescence ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Immunohistochemistry-Paraffin ISYNA1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NRAMP1/SLC11A1
Recombinant Protein A ...
NBP3-17904PEP
NRAMP1/SLC11A1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NRAMP1/SLC11A1 Recombinant Protein Antigen (NBP3-17904PEP) (0)

There are no publications for NRAMP1/SLC11A1 Recombinant Protein Antigen (NBP3-17904PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NRAMP1/SLC11A1 Recombinant Protein Antigen (NBP3-17904PEP) (0)

There are no reviews for NRAMP1/SLC11A1 Recombinant Protein Antigen (NBP3-17904PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NRAMP1/SLC11A1 Recombinant Protein Antigen (NBP3-17904PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NRAMP1/SLC11A1 Products

Blogs on NRAMP1/SLC11A1

There are no specific blogs for NRAMP1/SLC11A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NRAMP1/SLC11A1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC11A1