Nociceptin Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nociceptin. Source: E. coli Amino Acid Sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
PNOC |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58314. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Nociceptin Recombinant Protein Antigen
Background
Nociceptin (Orphanin FQ, OFQ), a heptadecapeptide peptide, has been designated as an endogenous ligand for the ORL1 receptor. The amino acid sequence of nociceptin hashomology with other opioid peptides, especially the prodynorphin fragment dynorphin A, suggesting a close evolutionary relationship between the precursors. A diffuse distribution throughout the brain is seen with binding studies and in situ hybridization suggesting an extensive role for nociceptin in a multitude of CNS functions. Immunocytochemical localizations in rat spinal cord have demonstrated nociceptin abundance in superficial dorsal horn, lateral spinal nucleus and the region dorsal to the central canal. Nociceptin immunoreactivity was not affected by dorsal rhizotomy, indicating that in spinal cord the peptide is produced by central rather than primary afferent neurons. The localization is supported by its function in processing of nociceptive signals.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: AC
Publications for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP) (0)
There are no publications for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP) (0)
There are no reviews for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP) (0)
Additional Nociceptin Products
Research Areas for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP)
Find related products by research area.
|
Blogs on Nociceptin