Novus Biologicals products are now on bio-techne.com

Nociceptin Recombinant Protein Antigen

Images

 
There are currently no images for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Nociceptin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nociceptin.

Source: E. coli

Amino Acid Sequence: RVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PNOC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58314.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nociceptin Recombinant Protein Antigen

  • nociceptin
  • nocistatin
  • OFQ
  • P
  • PPNOC
  • prepronociceptin
  • propronociceptin

Background

Nociceptin (Orphanin FQ, OFQ), a heptadecapeptide peptide, has been designated as an endogenous ligand for the ORL1 receptor. The amino acid sequence of nociceptin hashomology with other opioid peptides, especially the prodynorphin fragment dynorphin A, suggesting a close evolutionary relationship between the precursors. A diffuse distribution throughout the brain is seen with binding studies and in situ hybridization suggesting an extensive role for nociceptin in a multitude of CNS functions. Immunocytochemical localizations in rat spinal cord have demonstrated nociceptin abundance in superficial dorsal horn, lateral spinal nucleus and the region dorsal to the central canal. Nociceptin immunoreactivity was not affected by dorsal rhizotomy, indicating that in spinal cord the peptide is produced by central rather than primary afferent neurons. The localization is supported by its function in processing of nociceptive signals.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69143
Species: Hu
Applications: WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46290
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
MAB5826
Species: Hu
Applications: IHC, WB
MAB5285
Species: Hu
Applications: Simple Western, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31180
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-37856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-58314PEP
Species: Hu
Applications: AC

Publications for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP) (0)

There are no publications for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP) (0)

There are no reviews for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nociceptin Products

Research Areas for Nociceptin Recombinant Protein Antigen (NBP2-58314PEP)

Find related products by research area.

Blogs on Nociceptin

There are no specific blogs for Nociceptin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nociceptin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PNOC