Neurotensin Antibody Summary
Description |
Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen |
NTS (NP_006174.1, 1 a.a. - 170 a.a.) full-length human protein. MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
NTS |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for WB and Functional. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Neurotensin Antibody
Background
Neurotensin, also known as neurotensin/neuromedin N and NTS, is a member of the neurotensin family. Neurotensin is the precursor to the neuromedin N and neurotensin peptides. Neurotensin is a secreted tridecapeptide, which is widely distributed throughout the central nervous system, and may function as a neurotransmitter or a neuromodulator. Neurotensin is also involved in the endocrine and paracrine regulation of fat metabolism and smooth muscle contraction. Due to these involvements, neurotensin has been linked to dopamine-associated pathophysiological events.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: WB
Publications for Neurotensin Antibody (H00004922-B01P) (0)
There are no publications for Neurotensin Antibody (H00004922-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neurotensin Antibody (H00004922-B01P) (0)
There are no reviews for Neurotensin Antibody (H00004922-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neurotensin Antibody (H00004922-B01P). (Showing 1 - 1 of 1 FAQ).
-
Can you please send me the amino acid sequences of the immunogens used for generating your 7 different Neurotensin antibodies (H00004922-M03, H00004922-M01, H00004922-B01, H0000-B01P, H00004922-D01P, NBP1-50153, and NBP178333).
- The immunogen of H00004922-M01 and H00004922-M03 is amino acids 71-171 of the NTS protein (accession number is AAH10918). As for H00004922-B01, H00004922-B01P and H00004922-D01P, their immunogen is full-length human NTS protein (accession number NP_006174.1) To our knowledge these antibodies have not been epitope mapped.
Secondary Antibodies
| |
Isotype Controls
|
Additional Neurotensin Products
Research Areas for Neurotensin Antibody (H00004922-B01P)
Find related products by research area.
|
Blogs on Neurotensin