![Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-37940_rabbit-ndufa4-pab-101220241243922.jpg "Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1). Sequence: MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFA4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Intracellular Staining by Flow Cytometry ICA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ICA1_AF4084_Flow_Cytometry_8226.jpg)
![Immunohistochemistry ICA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4084_human-ica1-affinity-purified-polyclonal-ab-156202211583.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFA4 Antibody (NBP3-37940)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFA4 |
![Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of L929 cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-37940_rabbit-ndufa4-pab-101220241214455.jpg "Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of L929 cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Human liver using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-37940_rabbit-ndufa4-pab-1012202411552889.jpg "Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Human liver using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-37940_rabbit-ndufa4-pab-101220241243998.jpg "Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-37940_rabbit-ndufa4-pab-101220241252877.jpg "Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Flow Cytometry Integrin beta 8 Antibody (416922) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_8_MAB4775_Flow_Cytometry_8503.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")