Novus Biologicals products are now on bio-techne.com

Nav1.5 Recombinant Protein Antigen

Images

 
There are currently no images for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Nav1.5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nav1.5

Source: E. coli

Amino Acid Sequence: HKCVRNFTALNGTNGSVEADGLVWESLDLYLSDPENYLLKNGTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SCN5A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17744.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nav1.5 Recombinant Protein Antigen

  • cardiac sodium channel alpha subunit
  • cardiac tetrodotoxin-insensitive voltage-dependent sodium channel alpha subunit
  • CDCD2VF1
  • HB1sodium channel, voltage-gated, type V, alpha (long QT syndrome 3)
  • HB2
  • HBBD
  • HH1CMD1E
  • ICCD
  • IVF
  • LQT3SSS1CMPD2
  • Nav1.5
  • PFHB1
  • SCN5A
  • Sodium channel protein cardiac muscle subunit alpha
  • sodium channel protein type 5 subunit alpha
  • sodium channel protein type V alpha subunit
  • Sodium channel protein type V subunit alpha
  • sodium channel, voltage-gated, type V, alpha subunit
  • Voltage-gated sodium channel subunit alpha Nav1.5

Background

Nav1.5 is encoded by this gene is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The encoded protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram. Defects in this gene are a cause of long QT syndrome type 3 (LQT3), an autosomal dominant cardiac disease. Alternative splicing results in two transcript variants encoding separate isoforms which differ by a single amino acid. Mutation nomenclature has been assigned with respect to the longer isoform. This antibody is expected to recognise both reported isoforms (NP_000326 and NP_932173).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-38146
Species: Hu
Applications: IHC, IHC-P
H00006326-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
NBP1-47615
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
NBP3-41541
Species: Rt
Applications: ICC/IF, IHC, WB
NBP2-84125
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-12904
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, WB
NBP3-17744PEP
Species: Hu
Applications: AC

Publications for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP) (0)

There are no publications for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP) (0)

There are no reviews for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nav1.5 Products

Array NBP3-17744PEP

Research Areas for Nav1.5 Recombinant Protein Antigen (NBP3-17744PEP)

Find related products by research area.

Blogs on Nav1.5

There are no specific blogs for Nav1.5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nav1.5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SCN5A