![Immunocytochemistry/Immunofluorescence: Myosin 1B Antibody [NBP1-87739] - Staining of human cell line A-431 shows positivity in plasma membrane and cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87739-img0004.jpg "Immunocytochemistry/Immunofluorescence: Myosin 1B Antibody [NBP1-87739] - Staining of human cell line A-431 shows positivity in plasma membrane and cell junctions. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, Rt, ChSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LLNKLKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFMDHEAESVLAVVAAVLKLGNIEFKPESRVNGLDESKIKDKNELKEICELTGIDQSVLERAFSFRTVEAKQEKVSTTLNVA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYO1B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Luiz Alexandre Magno |
WB | Mouse | 10/17/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Myosin 1B Antibody (NBP1-87739)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYO1B |
![Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and in cells in tubules.](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87739-img0013.jpg "Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human kidney shows moderate membranous positivity in cells in glomeruli and in cells in tubules.")
![Western Blot: Myosin 1B Antibody [NBP1-87739] - (B) Western blot of Myo1b from freshly isolated ATII cells and ATII cells after 2 days of culture (0 and 2, respectively) to demonstrate expression of Myo1b in ATII cells. Ponceau S staining was used to control for equal protein loading (M, marker). Image collected and cropped by CiteAb from the following publication (//jcs.biologists.org/lookup/doi/10.1242/jcs.181313) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Western-Blot-NBP1-87739-img0018.jpg "Western Blot: Myosin 1B Antibody [NBP1-87739] - (B) Western blot of Myo1b from freshly isolated ATII cells and ATII cells after 2 days of culture (0 and 2, respectively) to demonstrate expression of Myo1b in ATII cells. Ponceau S staining was used to control for equal protein loading (M, marker). Image collected and cropped by CiteAb from the following publication (//jcs.biologists.org/lookup/doi/10.1242/jcs.181313) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87739-img0016.jpg "Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Western Blot: Myosin 1B Antibody [NBP1-87739] - Lysates of mouse whole brain in different developmental stages. Antibody at 1:1000. Molecular weight of the protein is around 130-140 KDa. Image submitted by a verified customer review](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Western-Blot-NBP1-87739-img0017.jpg "Western Blot: Myosin 1B Antibody [NBP1-87739] - Lysates of mouse whole brain in different developmental stages. Antibody at 1:1000. Molecular weight of the protein is around 130-140 KDa. Image submitted by a verified customer review")
![Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human liver shows moderate membranous positivity in hepatocytes.](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87739-img0014.jpg "Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human liver shows moderate membranous positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/Myosin-1B-Antibody-Immunohistochemistry-Paraffin-NBP1-87739-img0015.jpg "Immunohistochemistry-Paraffin: Myosin 1B Antibody [NBP1-87739] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.")
![Western Blot: Myosin 1B Antibody [NBP1-87739] - Expression & localization of Myo1b & Myo1c in ATII cells. (A) Semi-quantitative RT-PCR showed that Myo1b & Myo1c are among the highest expressed Myo1 isoforms in ATII cells. Data (mean±s.e.m.) obtained from three cell isolations & three experiments per isolation are shown relative to the expression of the housekeeping gene HMBS. Day 0, freshly isolated cells; Day 2, after 2 days in culture. (B) Western blot of Myo1b & Myo1c from freshly isolated ATII cells & ATII cells after 2 days of culture (0 & 2, respectively) to demonstrate expression of Myo1b & Myo1c in ATII cells. Ponceau S staining was used to control for equal protein loading (M, marker). (C) Colocalization of anti Myo1b & Myo1c staining with fused secretory vesicles marked by ABCa3 & phalloidin immunostaining. The ABCa3 transporter is a marker for secretory vesicle membrane in ATII cells. After ATP stimulation, some vesicles fused with the plasma membrane & acquired an actin coat, which was labeled by phalloidin staining (arrow). Scale bars: 10 µm. Insets show the enlarged view of the fused lamellar bodies. Scale bars: 1 µm. Image collected & cropped by CiteAb from the following publication (//journals.biologists.com/jcs/article/doi/10.1242/jcs.181313/260175/The-role-of-myosin-1c-and-myosin-1b-for-surfactant), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-87739_rabbit-polyclonal-myosin-1b-antibody-310202416114745.jpg "Western Blot: Myosin 1B Antibody [NBP1-87739] - Expression & localization of Myo1b & Myo1c in ATII cells. (A) Semi-quantitative RT-PCR showed that Myo1b & Myo1c are among the highest expressed Myo1 isoforms in ATII cells. Data (mean±s.e.m.) obtained from three cell isolations & three experiments per isolation are shown relative to the expression of the housekeeping gene HMBS. Day 0, freshly isolated cells; Day 2, after 2 days in culture. (B) Western blot of Myo1b & Myo1c from freshly isolated ATII cells & ATII cells after 2 days of culture (0 & 2, respectively) to demonstrate expression of Myo1b & Myo1c in ATII cells. Ponceau S staining was used to control for equal protein loading (M, marker). (C) Colocalization of anti Myo1b & Myo1c staining with fused secretory vesicles marked by ABCa3 & phalloidin immunostaining. The ABCa3 transporter is a marker for secretory vesicle membrane in ATII cells. After ATP stimulation, some vesicles fused with the plasma membrane & acquired an actin coat, which was labeled by phalloidin staining (arrow). Scale bars: 10 µm. Insets show the enlarged view of the fused lamellar bodies. Scale bars: 1 µm. Image collected & cropped by CiteAb from the following publication (//journals.biologists.com/jcs/article/doi/10.1242/jcs.181313/260175/The-role-of-myosin-1c-and-myosin-1b-for-surfactant), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
