![Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - The antibody was tested in mouse skeletal muscle and shows a band below 75 kDa. This image was submitted via customer Review. *{Mouse WB}*](http://images.novusbio.com/fullsize/MYLK2-Antibody-2G1-Western-Blot-H00085366-M01-img0005.jpg "Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - The antibody was tested in mouse skeletal muscle and shows a band below 75 kDa. This image was submitted via customer Review. *{Mouse WB}*")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, KD |
| Clone | 2G1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | MYLK2 (NP_149109, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLLAKKPPSEASELTFEGVPMTHSPTDPRPAKAEEGKNILAESQKEVGEKTPGQAGQAKMQGDTSRGIEFQAVPSEKSEVGQALCLTAREEDCFQILDDC |
| Localization | Cytoplasmic |
| Specificity | MYLK2 - myosin light chain kinase 2, skeletal muscle |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MYLK2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. It has also been used for RNAi validation. |
|
| Reviewed Applications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 05/31/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MYLK2 Antibody (H00085366-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 over-expressed 293 cell line, cotransfected with MYLK2 Validated Chimera RNAi ( Cat # H00085366-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYLK2 monoclonal antibody (M01), clone 2G1 (Cat # H00085366-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/MYLK2-Antibody-2G1-Western-Blot-H00085366-M01-img0003.jpg "Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 over-expressed 293 cell line, cotransfected with MYLK2 Validated Chimera RNAi ( Cat # H00085366-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYLK2 monoclonal antibody (M01), clone 2G1 (Cat # H00085366-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 expression in transfected 293T cell line by MYLK2 monoclonal antibody (M01), clone 2G1.Lane 1: MYLK2 transfected lysate(64.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/MYLK2-Antibody-2G1-Western-Blot-H00085366-M01-img0004.jpg "Western Blot: MYLK2 Antibody (2G1) [H00085366-M01] - Analysis of MYLK2 expression in transfected 293T cell line by MYLK2 monoclonal antibody (M01), clone 2G1.Lane 1: MYLK2 transfected lysate(64.7 KDa).Lane 2: Non-transfected lysate.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot MRCL3 [p Ser19, p Ser20] Antibody](https://images.novusbio.com/images/MRCL3-[p-Ser19--p-Ser20]-Antibody-Western-Blot-NB100-1687-img0019.jpg)
![Immunohistochemistry MRCL3 [p Ser19, p Ser20] Antibody](https://images.novusbio.com/images/nb100-1687_rabbit-polyclonal-mrcl3-p-ser19-p-ser20-antibody-23520231814583.jpg)
![Immunohistochemistry MRCL3 [p Ser19, p Ser20] Antibody](https://images.novusbio.com/images/nb100-1687_rabbit-polyclonal-mrcl3-p-ser19-p-ser20-antibody-235202318143193.jpg)
![Immunohistochemistry Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_9_AF3827_Immunohistochemistry_24134.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412394961.jpg)
![Immunocytochemistry/ Immunofluorescence Integrin alpha 9 Antibody [Unconjugated]](https://images.novusbio.com/images/af3827_mouse-integrin-alpha-9-affinity-purified-polyclonal-ab-41202412402515.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
