Myelin Protein Zero Antibody (3C4D1) Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 149-248 of human Myelin Protein Zero (MPZ) (NP_000521.2).
Sequence: KVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
MPZ |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA Recommended starting concentration is 1 ug/mL
- Western Blot 1:2000 - 1:20000
|
Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.05% Proclin 300 |
Purity |
Affinity purified |
Alternate Names for Myelin Protein Zero Antibody (3C4D1)
Background
Myelin Protein Zero encodes a major structural protein of peripheral myelin. Mutations in this gene result in the autosomal dominant form of Charcot-Marie-Tooth disease type 1 as other polyneuropathies. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: BA
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IP (-), WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Publications for Myelin Protein Zero Antibody (NBP3-33312) (0)
There are no publications for Myelin Protein Zero Antibody (NBP3-33312).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myelin Protein Zero Antibody (NBP3-33312) (0)
There are no reviews for Myelin Protein Zero Antibody (NBP3-33312).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myelin Protein Zero Antibody (NBP3-33312) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myelin Protein Zero Products
Research Areas for Myelin Protein Zero Antibody (NBP3-33312)
Find related products by research area.
|
Blogs on Myelin Protein Zero