Home » MTMR3 » MTMR3 Proteins » MTMR3 Recombinant Protein Antigen

MTMR3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MTMR3 Protein (NBP1-81861PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

MTMR3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTMR3.

Source: E. coli

Amino Acid Sequence: MEPSPSETSLVERPQVGSVVHRTSLGSTLSLTRSPCALPLAECKEGLVCNGAPETENRASEQPPGLSTLQMYPTPNGHCANGEAGRSKDSLSR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTMR3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81861.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTMR3 Recombinant Protein Antigen

  • FLJ32333
  • FYVE-DSP1FYVE domain containing 10
  • myotubularin related protein 3

Background

MTMR3encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Myotubularin
Antibody
NB300-949
Immunohistochemistry-Paraffin Myotubularin Antibody
Western Blot Myotubularin Antibody
Western Blot Myotubularin Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
MTMR4 Antibody -
Azide and BSA Free
NBP2-94706
Immunocytochemistry/ Immunofluorescence MTMR4 Antibody - Azide and BSA Free
Western Blot MTMR4 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence MTMR4 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
MTMR2 Antibody
(4G6)
H00008898-M03
ELISA MTMR2 Antibody (4G6)
Western Blot MTMR2 Antibody (4G6)
Western Blot MTMR2 Antibody (4G6)
(1 Publication)
Species: Hu, Rt
Applications: ELISA, WB
MTMR1 Antibody
NBP1-86042
Western Blot MTMR1 Antibody
Immunohistochemistry-Paraffin MTMR1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MTMR6 Antibody -
Azide and BSA Free
NBP2-94705
Western Blot MTMR6 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
WIPI1 Antibody
NBP1-88878
Western Blot WIPI1 Antibody
Immunohistochemistry-Paraffin WIPI1 Antibody
Immunohistochemistry-Paraffin WIPI1 Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
MTMR9 Antibody
NB100-832
Immunohistochemistry-Paraffin MTMR9 Antibody
Immunocytochemistry/ Immunofluorescence MTMR9 Antibody
Immunocytochemistry/ Immunofluorescence MTMR9 Antibody
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
SSH2 Antibody
H00085464-D01P
Western Blot SSH2 Antibody
(1 Publication)
Species: Hu, Mu
Applications: WB
MTMR8 Antibody -
Azide and BSA Free
NBP2-94380
Western Blot MTMR8 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MTMR8 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MTMR8 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Reg1A Antibody
(431202) [Unconjugate
MAB4937
Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/ Immunofluorescence RPLP2 Antibody
Immunohistochemistry-Paraffin RPLP2 Antibody
Western Blot RPLP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

FABP8/M-FABP/Myelin P2
AF5866
Western Blot FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Immunohistochemistry FABP8/M-FABP/Myelin P2 Protein Antibody
Species: Hu
Applications: IHC, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody
Western Blot Smad3 Antibody
Immunohistochemistry-Paraffin Smad3 Antibody
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
26S proteasome
subunit 9 Antibody
NBP2-47560
Immunohistochemistry 26S proteasome subunit 9 Antibody
Immunohistochemistry-Paraffin 26S proteasome subunit 9 Antibody
Immunohistochemistry-Paraffin 26S proteasome subunit 9 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ZMIZ1/Zimp10
Antibody
AF8107
Western Blot ZMIZ1/Zimp10 Antibody
Immunohistochemistry ZMIZ1/Zimp10 Antibody
Species: Hu
Applications: IHC, WB
Calpain 10 Antibody
H00011132-D01P
Western Blot Calpain 10 Antibody
Immunocytochemistry/ Immunofluorescence Calpain 10 Antibody
Species: Hu
Applications: ICC/IF, WB
Integrin alpha
2/CD49b Antibody (HAS ...
MAB1233
Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
DcR3/TNFRSF6B
[Biotin]
DY142
N/A DcR3/TNFRSF6B [Biotin]
(14 Publications)
Species: Hu
Applications: ELISA
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB

Publications for MTMR3 Protein (NBP1-81861PEP) (0)

There are no publications for MTMR3 Protein (NBP1-81861PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTMR3 Protein (NBP1-81861PEP) (0)

There are no reviews for MTMR3 Protein (NBP1-81861PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTMR3 Protein (NBP1-81861PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTMR3 Products

Array NBP1-81861PEP

Research Areas for MTMR3 Protein (NBP1-81861PEP)

Find related products by research area.

Blogs on MTMR3

There are no specific blogs for MTMR3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: Smad3 Antibody [NB100-56479] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton X-100. The cells were incubated with anti-Smad3 at 10 ug/mL overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Smad3 Antibody
NB100-56479

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTMR3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MTMR3