Novus Biologicals products are now on bio-techne.com

MMP-2 Recombinant Protein Antigen

Images

 
There are currently no images for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

MMP-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP2.

Source: E. coli

Amino Acid Sequence: YGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MMP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54667.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-2 Recombinant Protein Antigen

  • 72 kDa gelatinase
  • CLG4
  • CLG4A72 kDa type IV collagenase
  • collagenase type IV-A
  • EC 3.4.24
  • EC 3.4.24.24
  • Gelatinase A
  • matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IVcollagenase)
  • matrix metalloproteinase 2 (gelatinase A, 72kD gelatinase, 72kD type IVcollagenase)
  • Matrix metalloproteinase-2
  • matrix metalloproteinase-II
  • MMP2
  • MMP-2
  • MMP-II
  • MONA
  • neutrophil gelatinase
  • TBE-1matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IVcollagenase)

Background

MMP2 is a member of the Matrix Metalloproteinase (MMP) family, which are involved in extracellular matrix degradation under both normal physiological and disease processes. Specifically, MMP-2 is responsible for degrading collagens type IV, V, VII, and X and gelatin type I. Other reported functions of MMP 2 include angiogenesis, tumor invasion, tissue repair, remodeling of the vasculature, inflammation, and atherosclerotic plaque rupture. MMP-2 secretion is activated by the Ras signaling pathway. MMP2 triggers cells to begin migration by cleaving laminin-5 and exposing an integrin-binding site on the epithelial basement membrane. The cleaved of laminin has been detected in tumors and in tissues being altered, howver the activated form of MMP2 is not found in benign tumors. Thus, detection of MMP2 is a possible early indicator of tumor activity. MMP2 is most strongly expressed in normal skin fibroblasts, but may also be found in gliomas, breast and prostate tumors. Mutations in the MMP-2 gene have been linked to Torg-Winchester syndrome, Nodulosis-Arthropathy-Osteolysis (NAO) syndrome, and arthritis. Additionally, abnormal expression of matrix matalloproteinases have been associated with neoplastic traits such as loss of negative growth regulation and high invasive potential.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMP900
Species: Hu
Applications: ELISA
DTM100
Species: Hu
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
DVE00
Species: Hu
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
1310-SE
Species: Hu
Applications: EnzAct
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
M6000B
Species: Mu
Applications: ELISA
DM1300
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
DMP700
Species: Hu
Applications: ELISA

Publications for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP) (0)

There are no publications for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP) (0)

There are no reviews for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMP-2 Products

Research Areas for MMP-2 Recombinant Protein Antigen (NBP2-54667PEP)

Find related products by research area.

Blogs on MMP-2.

MMP-2: More Than a Cancer Marker
Matrix metalloproteinases (MMP) are a family of endopeptidases involved in the breakdown of extracellular matrix (ECM) during both normal physiological and disease processes. MMP-2 is a zinc-dependent family member that selectively cleaves collagen...  Read full blog post.

CD63: is it pro-metastatic or anti-metastatic?
CD63 is a type II membrane protein belonging to tetraspanin superfamily and it play key roles in the activation of several cellular signaling cascades along with acting as TIMP1 receptor. It is expressed by activated platelets, monocytes,...  Read full blog post.

Integrin alpha v beta 3 - a target for inhibiting tumor angiogenesis
Integrins are a family of transmembrane proteins involved in diverse processes including cell adhesion, signal transduction, cell migration, and differentiation. They exist as heterodimers consisting of noncovalently linked alpha and beta subunits....  Read full blog post.

Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component
Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMP-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP2