Novus Biologicals products are now on bio-techne.com

MLX Recombinant Protein Antigen

Images

 
There are currently no images for MLX Protein (NBP2-37937PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

MLX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLX.

Source: E. coli

Amino Acid Sequence: EEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-37937.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLX Recombinant Protein Antigen

  • BHLHD13
  • bHLHd13Max-like bHLHZip protein
  • BigMax alpha
  • BigMax protein
  • Class D basic helix-loop-helix protein 13
  • MAD7
  • MAX-like protein X
  • MLX
  • MXD7
  • TCFL4
  • TCFL4Protein BigMax
  • transcription factor-like 4
  • Transcription factor-like protein 4

Background

Max is a nuclear localized bHLH-Zip protein that forms homodimers or heterodimers with Myc family members, including Myc, Mad 1, Mad 3, Mad 4, Mxi1 and Mnt (or Rox). These dimers bind to the E-box sequence CACGTG in order to regulate cell growth, proliferation and apoptosis. Mlx (Max-like protein X) is a bHLH-Zip protein that is structurally and functionally related to Max. Like Max, Mlx is broadly expressed in many tissues and has a long half-life. Mlx also forms homodimers or heterodimers with members of the Myc family, specifically Mad 1, Mad 4 and Rox, and members of the Mondo family, to repress or activate transcription from CACGTG E-boxes. MondoA forms weak homodimers and preferentially forms heterodimers with Mlx. The MondoA/Mlx complex is primarily localized to the cytoplasm, but will translocate to the nucleus in response to leptomycin B. Mlx can also dimerize with WBSCR14, a protein involved in Williams-Beuren syndrome (WBS), to repress E-box transcription, which provides further evidence that Mlx is a critical element in a transcription factor network.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-33596
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PAGE, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
PP-H8132-00
Species: Hu
Applications: IHC, IP, WB
AF2400
Species: Hu
Applications: ChIP, ICC, IHC, WB
NB400-135
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, GS, IB, ICC/IF, IHC, IHC-P, IP, KD, KO, PAGE, WB
PP-H7147-00
Species: Hu
Applications: IHC, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45269
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-610
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NLS5411
Species: Ha, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
AF6277
Species: Hu
Applications: ICC, WB
AF2419
Species: Hu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB

Publications for MLX Protein (NBP2-37937PEP) (0)

There are no publications for MLX Protein (NBP2-37937PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLX Protein (NBP2-37937PEP) (0)

There are no reviews for MLX Protein (NBP2-37937PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLX Protein (NBP2-37937PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLX Products

Blogs on MLX.

ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer
ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in ...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLX Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MLX