![Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/MKKS-Antibody-Western-Blot-NBP1-92123-img0006.jpg "Western Blot: MKKS Antibody [NBP1-92123] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSTALKVALFCTTLSGDTSDTGEGTVVVSYGVSLENAVLDQLLNLGRQLISDHVDLVLCQKVIHPSLKQFLNMHRIIAIDRIGVTLMEPLTK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MKKS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MKKS Antibody (NBP1-92123)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MKKS |
![Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92123-img0008.jpg "Immunocytochemistry/Immunofluorescence: MKKS Antibody [NBP1-92123] - Immunofluorescent staining of human cell line U-2 OS shows localization to centrosome.")
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human urinary bladder.](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0012.jpg "Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human urinary bladder.")
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0007.jpg "Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon shows strong cytoplasmic and nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon, kidney, testis and urinary bladder using Anti-MKKS antibody NBP1-92123 (A) shows similar protein distribution across tissues to independent antibody NBP1-92122 (B).](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0009.jpg "Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon, kidney, testis and urinary bladder using Anti-MKKS antibody NBP1-92123 (A) shows similar protein distribution across tissues to independent antibody NBP1-92122 (B).")
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human kidney.](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0010.jpg "Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human testis.](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0011.jpg "Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human testis.")
![Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon.](http://images.novusbio.com/fullsize/MKKS-Antibody-Immunohistochemistry-Paraffin-NBP1-92123-img0013.jpg "Immunohistochemistry-Paraffin: MKKS Antibody [NBP1-92123] - Staining of human colon.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")