Home » MITF » MITF Proteins » MITF Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MITF Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MITF Protein (NBP1-88618PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MITF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MITF.

Source: E. coli

Amino Acid Sequence: HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MITF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88618.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MITF Recombinant Protein Antigen

  • bHLHe32
  • bHLHe32MI
  • Class E basic helix-loop-helix protein 32
  • MI
  • microphthalmia-associated transcription factor
  • MITF
  • Waardenburg syndrome, type 2A
  • WS2A

Background

MITF (microphthalmia-associated transcription factor) is a melanocytic nuclear protein that contains basic helix-loop-helix (HLH) and leucine zipper (LZ) domains. These protein motifs are frequently observed in other transcription factors and are particularly common to members of the Myc family. MITF can directly associate with DNA as a homodimer. It is required for the development and differentiation of melanocytes. Its expression is upregulated by cAMP and cAMP dependent pathways. MITF activates several different gene promoters by binding to their E-boxes. Tyrosinase, TRP-1 and TRP-2 are pigment synthesis genes activated by MITF. When MITF is phosphorylated on Serine 73 (via the MAPK pathway), it associates with coactivators of the p300/CBP family and enhances transcription. MITF has several isoforms including MITF-M which is specifically expressed in melanocytes. In Mitfdeficient mice there is a complete absence of melanocytes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
TYRP1 Antibody
NBP1-88370
Western Blot TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
Immunohistochemistry-Paraffin TYRP1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Serpin A5/Protein
C Inhibitor Antibody ...
MAB1266
Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
TRP2 Antibody
NBP1-86893
Immunohistochemistry-Paraffin TRP2 Antibody
Immunohistochemistry-Paraffin TRP2 Antibody
Western Blot TRP2 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Calretinin Antibody
NBP1-88220
Immunocytochemistry/ Immunofluorescence Calretinin Antibody
Western Blot Calretinin Antibody
Immunohistochemistry-Paraffin Calretinin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
CD21 Antibody
(SC0681)
NBP2-67605
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunohistochemistry-Paraffin CD21 Antibody (SC0681)
(1 Publication)
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
CRIPTO Antibody
[Unconjugated]
AF1538
Immunocytochemistry CRIPTO Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: Block, ICC, WB
DHRS4 Antibody
NBP2-98675
Immunohistochemistry-Paraffin DHRS4 Antibody
Immunohistochemistry-Paraffin DHRS4 Antibody
Western Blot DHRS4 Antibody
Species: Hu
Applications: IHC-P, IP, WB
Pax3/Pax7 Antibody
(274212) [Unconjugate ...
MAB2457
Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]
Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western CD117/c-kit Antibody [Unconjugated]
Western Blot CD117/c-kit Antibody [Unconjugated]
Immunohistochemistry CD117/c-kit Antibody [Unconjugated]
(4 Reviews)
(116 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MITF Recombinant
Protein Antigen
NBP1-88618PEP
MITF Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MITF Protein (NBP1-88618PEP) (0)

There are no publications for MITF Protein (NBP1-88618PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MITF Protein (NBP1-88618PEP) (0)

There are no reviews for MITF Protein (NBP1-88618PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MITF Protein (NBP1-88618PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MITF Products

Blogs on MITF.

Check out the latest blog posts on MITF.
Epigenetic Control of Autophagy
By Christina Towers, PhD. In the last 20 years, epigenetic regulation has become front and center for almost all fields of biology and its role in diseases like cancer and neurodegeneration are being heavily studi...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit Antibody [Unconjugated]
AF1356

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MITF Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MITF