Melanocortin-3 R/MC3R Antibody Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human Melanocortin-3 R/MC3R (NP_063941.3). Peptide sequence PTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCN |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MC3R |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Melanocortin-3 R/MC3R Antibody
Background
Melanocortins are ligands for a subgroup of GPCRs positively coupled to Adenylate cylcases, termed as melanocortin receptors (MC1R, MC2R, MC3R, MC4R amd MC5R). These receptors are widely expressed at varied density throughout the body. The MC3R has been widely implicated in inflammation and is also implicated in a role in obesity and metabolism. MC3R KO mice exhibit reduced linear growth and lean mass and are hyperleptinemic and hyperinsulinemic.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Publications for Melanocortin-3 R/MC3R Antibody (NBP3-10027) (0)
There are no publications for Melanocortin-3 R/MC3R Antibody (NBP3-10027).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Melanocortin-3 R/MC3R Antibody (NBP3-10027) (0)
There are no reviews for Melanocortin-3 R/MC3R Antibody (NBP3-10027).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Melanocortin-3 R/MC3R Antibody (NBP3-10027) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Melanocortin-3 R/MC3R Products
Research Areas for Melanocortin-3 R/MC3R Antibody (NBP3-10027)
Find related products by research area.
|
Blogs on Melanocortin-3 R/MC3R