MARK2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MARK2. Source: E. coli Amino Acid Sequence: EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MARK2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57851. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MARK2 Recombinant Protein Antigen
Background
EMK (ELKL Motif Kinase) is a small family of ser/thr protein kinases involved in the control of cell polarity, microtubule stability and cancer. Several cDNA clones have been isolated that encoded two isoforms of the human ser/thr protein kinase EMK1. These isoforms were characterized by the presence of a 162-bp alternative exon that gave rise to two forms, one containing the exon and the other one lacking it. Both forms were found to be coexpressed in a number of selected cell lines and tissue samples. The human EMK1 was shown to be encoded by a single mRNA ubiquitously expressed. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Publications for MARK2 Recombinant Protein Antigen (NBP2-57851PEP) (0)
There are no publications for MARK2 Recombinant Protein Antigen (NBP2-57851PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MARK2 Recombinant Protein Antigen (NBP2-57851PEP) (0)
There are no reviews for MARK2 Recombinant Protein Antigen (NBP2-57851PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MARK2 Recombinant Protein Antigen (NBP2-57851PEP) (0)
Additional MARK2 Products
Research Areas for MARK2 Recombinant Protein Antigen (NBP2-57851PEP)
Find related products by research area.
|
Blogs on MARK2
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Western Blot EPCR Antibody [Unconjugated]](https://images.novusbio.com/images2/EPCR_AF2245_Western_Blot_20829.jpg)
![Immunohistochemistry EPCR Antibody [Unconjugated]](https://images.novusbio.com/images2/EPCR_AF2245_Immunohistochemistry_6739.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/CD40_Ligand_DCDL40_ELISA_60.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/DATA_CD40_Ligand_DCDL40_ELISA_624.jpg)
![Western Blot of Rabbit MARK2 [p Thr595] Antibody antibody. Lane 1: wild type Jurkat cells. Lane 2: wild type Jurkat cells stimulated with CD3/CD28 (T-cell receptor stimulation). Load: 35 ug per lane. Primary antibody: MARK2 pT595 antibody at 1:500 for overnight at 4C. Secondary antibody: IRDye800(TM) rabbit secondary antibody at 1:10,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: ~83 kDa for MARK2pT595.](https://images.novusbio.com/images/nbp1-78028_rabbit-polyclonal-mark2-p-thr595-antibody-255202313135151.jpg "Western Blot of Rabbit MARK2 [p Thr595] Antibody antibody. Lane 1: wild type Jurkat cells. Lane 2: wild type Jurkat cells stimulated with CD3/CD28 (T-cell receptor stimulation). Load: 35 ug per lane. Primary antibody: MARK2 pT595 antibody at 1:500 for overnight at 4C. Secondary antibody: IRDye800(TM) rabbit secondary antibody at 1:10,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: ~83 kDa for MARK2pT595.")