MARK2 Recombinant Protein Antigen

Images

 
There are currently no images for MARK2 Protein (NBP1-84848PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

MARK2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MARK2.

Source: E. coli

Amino Acid Sequence: SIFSKFTSKFVRRNLNEPESKDRVETLRPHVVGSGGNDKEKEEFREAKPRSLRFTWSMKTTSSMEPNE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MARK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84848.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MARK2 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • ELKL motif kinase 1
  • ELKL motif kinase
  • EMK-1
  • EMK1PAR-1
  • MAP/microtubule affinity-regulating kinase 2MGC99619
  • PAR1 homolog
  • Par1b
  • Ser/Thr protein kinase PAR-1B
  • serine/threonine protein kinase EMK
  • serine/threonine-protein kinase MARK2

Background

EMK (ELKL Motif Kinase) is a small family of ser/thr protein kinases involved in the control of cell polarity, microtubule stability and cancer. Several cDNA clones have been isolated that encoded two isoforms of the human ser/thr protein kinase EMK1. These isoforms were characterized by the presence of a 162-bp alternative exon that gave rise to two forms, one containing the exon and the other one lacking it. Both forms were found to be coexpressed in a number of selected cell lines and tissue samples. The human EMK1 was shown to be encoded by a single mRNA ubiquitously expressed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP1-81746
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS261
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
NBP1-87338
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP1-33409
Species: Hu
Applications: ICC/IF, WB
AF2245
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-25162
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DCDL40
Species: Hu
Applications: ELISA
2914-HT
Species: Hu
Applications: BA

Publications for MARK2 Protein (NBP1-84848PEP) (0)

There are no publications for MARK2 Protein (NBP1-84848PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARK2 Protein (NBP1-84848PEP) (0)

There are no reviews for MARK2 Protein (NBP1-84848PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MARK2 Protein (NBP1-84848PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MARK2 Products

Research Areas for MARK2 Protein (NBP1-84848PEP)

Find related products by research area.

Blogs on MARK2

There are no specific blogs for MARK2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MARK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MARK2