Home » LZTS1 » LZTS1 Proteins » LZTS1 Recombinant Protein Antigen

LZTS1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LZTS1 Protein (NBP1-83908PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LZTS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LZTS1.

Source: E. coli

Amino Acid Sequence: TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LZTS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83908.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LZTS1 Recombinant Protein Antigen

  • F37
  • F37/esophageal cancer-related gene-coding leucine-zipper motifFez1
  • FEZ1leucine zipper putative tumor suppressor 1
  • leucine zipper, putative tumor suppressor 1

Background

LZTS1, also known as leucine zipper putative tumor suppressor 1, consists of seven isoforms of sizes 66.6 kDa, 63.8 kDa, 62.9 kDa, 59.8 kDa, 55.6 kDa, 22.5 kDa, and 8.6 kDa and is involved in suppressing tumors by regulating cell growth. Diseases and disorder such as breast cancer, ovarian cancer, melanoma, esophagitis, squamous cell carcinoma, lung cancer, and prostatitis are being researched with the protein. The protein interacts in transcription, gene expression, and RNA Polymerase III transcription initiation pathways with CDK1, GTF3A, CDC25C, EEF1G, and GTF3C1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DISC1 Antibody
NB110-40773
Immunohistochemistry DISC1 Antibody
Immunocytochemistry/ Immunofluorescence DISC1 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Nudel Antibody
(OTI5E11)
NBP2-01086
Flow Cytometry Nudel Antibody (OTI5E11)
Western Blot Nudel Antibody (OTI5E11)
Immunohistochemistry-Paraffin Nudel Antibody (OTI5E11)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
LIS1 Antibody
NBP1-87769
Immunocytochemistry/ Immunofluorescence LIS1 Antibody
Immunohistochemistry-Paraffin LIS1 Antibody
Immunohistochemistry-Paraffin LIS1 Antibody
(2 Reviews)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(43 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CIB1 Antibody
(791119) [Unconjugate
MAB7557
Western Blot CIB1 Antibody (791119) [Unconjugated]
Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
CDC2/CDK1 Antibody
NBP1-85729
Immunohistochemistry-Paraffin CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
Western Blot CDC2/CDK1 Antibody
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
UBE4B Antibody
NBP1-84943
Western Blot UBE4B Antibody
Immunohistochemistry-Paraffin UBE4B Antibody
Western Blot UBE4B Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
LZTS2 Antibody -
BSA Free
NBP2-41152
Immunohistochemistry LZTS2 Antibody - BSA Free
Immunohistochemistry-Paraffin LZTS2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence LZTS2 Antibody - BSA Free
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
CDC25C Antibody
(461908) [Unconjugate
MAB4459
Western Blot CDC25C Antibody (461908) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB
JIP1 Antibody
AF4366
Western Blot JIP1 Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB
ZNF312 Antibody -
Azide and BSA Free
NBP2-94378
Western Blot ZNF312 Antibody - Azide and BSA Free
Species: Hu, Rt
Applications: WB
PDE4B Antibody
(OTI1D12)
NBP2-01171
Flow Cytometry PDE4B Antibody (OTI1D12)
Flow Cytometry PDE4B Antibody (OTI1D12)
Western Blot PDE4B Antibody (OTI1D12)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FEZ2 Antibody -
BSA Free
NBP2-81716
Western Blot FEZ2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence FEZ2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence FEZ2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
FHIT Antibody
NBP1-89062
Western Blot FHIT Antibody
Immunohistochemistry-Paraffin FHIT Antibody
Immunohistochemistry-Paraffin FHIT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB

PLA2G7/PAF-AH/Lp-PLA2
DPLG70
N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]
N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]
(1 Review)
(14 Publications)
Species: Hu
Applications: ELISA
Pericentrin
Antibody
NBP1-87772
Immunohistochemistry-Paraffin Pericentrin Antibody
Immunohistochemistry-Paraffin Pericentrin Antibody
Immunohistochemistry-Paraffin Pericentrin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for LZTS1 Protein (NBP1-83908PEP) (0)

There are no publications for LZTS1 Protein (NBP1-83908PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LZTS1 Protein (NBP1-83908PEP) (0)

There are no reviews for LZTS1 Protein (NBP1-83908PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LZTS1 Protein (NBP1-83908PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LZTS1 Products

Research Areas for LZTS1 Protein (NBP1-83908PEP)

Find related products by research area.

Blogs on LZTS1

There are no specific blogs for LZTS1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
p53 Antibody (PAb 240) - BSA Free
NB200-103
N/A PLA2G7/PAF-AH/Lp-PLA2 [HRP]
PLA2G7/PAF-AH/Lp-PLA2 [HRP]
DPLG70
Immunohistochemistry-Paraffin: Pericentrin Antibody [NBP1-87772] - Staining of human testis shows high expression.
Pericentrin Antibody
NBP1-87772

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LZTS1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LZTS1