![Western Blot: LMAN2L Antibody [H00081562-B01P] - Analysis of LMAN2L expression in transfected 293T cell line by LMAN2L polyclonal antibody. Lane 1: LMAN2L transfected lysate(38.28 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/LMAN2L-Antibody-Western-Blot-H00081562-B01P-img0002.jpg "Western Blot: LMAN2L Antibody [H00081562-B01P] - Analysis of LMAN2L expression in transfected 293T cell line by LMAN2L polyclonal antibody. Lane 1: LMAN2L transfected lysate(38.28 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | LMAN2L (NP_110432, 1 a.a. - 348 a.a.) full-length human protein. MAATLGPLGSWQQWRRCLSARDGSRMLLLLLLLGSGQGPQQVGAGQTFEYLKREHSLSKPYQGVGTGSSSLWNLMGNAMVMTQYIRLTPDMQSKQGALWNRVPCFLRDWELQVHFKIHGQGKKNLHGDGLAIWYTKDRMQPGPVFGNMDKFVGLGVFVDTYPNEEKQQERVFPYISAMVNNGSLSYDHERDGRPTELGGCTAIVRNLHYDTFLVIRYVKRHLTIMMDIDGKHEWRDCIEVPGVRLPRGYYFGTSSITGDLSDNHDVISLKLFELTVERTPEEEKLHRDVFLPSVDNMKLPEMTAPLPPLSGLALFLIVFFSLVFSVFAIVIGIILYNKWQEQSRKRFY |
| Specificity | LMAN2L - lectin, mannose-binding 2-like, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | LMAN2L |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry KIR2DL3/CD158b2 Antibody (180701) [Unconjugated]](https://images.novusbio.com/images2/KIR2DL3_MAB2014_Flow_Cytometry_23697.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")