Home » Kv1.3 » Kv1.3 Proteins » Kv1.3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Kv1.3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Kv1.3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Kv1.3.

Source: E. coli

Amino Acid Sequence: EEQSQYMHVGSCQHLSSSAEELRKARSNSTLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KCNA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48533.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Kv1.3 Recombinant Protein Antigen

  • HGK5
  • HLK3
  • HLK3KV1.3
  • HPCN3
  • HPCN3PCN3
  • HUKIII
  • KCNA3
  • Kv1.3
  • MK3
  • potassium channel 3
  • potassium voltage-gated channel subfamily A member 3
  • potassium voltage-gated channel, shaker-related subfamily, member 3
  • type n potassium channel
  • Voltage-gated K(+) channel HuKIII
  • voltage-gated potassium channel protein Kv1.3
  • Voltage-gated potassium channel subunit Kv1.3

Background

KCNA3 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kv1.2 Antibody
NBP3-10293
Western Blot Kv1.2 Antibody
Species: Hu
Applications: WB
Kv1.1 Antibody -
Azide and BSA Free
NBP3-03729
Immunohistochemistry Kv1.1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Kv1.5 Antibody
NBP2-76939
Western Blot Kv1.5 Antibody
Immunocytochemistry/ Immunofluorescence Kv1.5 Antibody
Immunocytochemistry/ Immunofluorescence Kv1.5 Antibody
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
KCNN4 Antibody
NBP2-33694
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
Immunohistochemistry-Paraffin KCNN4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Kv1.4 Antibody -
Azide and BSA Free
NBP3-02980
Western Blot Kv1.4 Antibody - Azide and BSA Free
Species: Mu, Rt
Applications: WB
KCNB1 Antibody
NBP2-38498
Immunohistochemistry-Paraffin KCNB1 Antibody
Immunohistochemistry-Paraffin KCNB1 Antibody
Immunohistochemistry-Paraffin KCNB1 Antibody
Species: Hu
Applications: IHC, IHC-P
Kv1.6 Antibody
NBP3-24946
Immunocytochemistry/ Immunofluorescence Kv1.6 Antibody
Species: Hu
Applications: ICC/IF
Kv4.3 Antibody -
Azide and BSA Free
NBP3-03750
Immunohistochemistry-Paraffin Kv4.3 Antibody - Azide and BSA Free
Western Blot Kv4.3 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
Potassium Channel
Kv3.1 [p Ser503] Anti ...
NB300-279
Immunohistochemistry Potassium Channel Kv3.1 [p Ser503] Antibody
(6 Publications)
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAPKAPK2 Antibody
(2B3)
H00009261-M01
Proximity Ligation Assay MAPKAPK2 Antibody (2B3)
Immunocytochemistry/ Immunofluorescence MAPKAPK2 Antibody (2B3)
Immunohistochemistry-Paraffin MAPKAPK2 Antibody (2B3)
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Kv4.2 Antibody -
BSA Free
NBP3-03748
Western Blot Kv4.2 Antibody - BSA Free
(1 Review)
Species: Mu
Applications: IHC, IHC-P, WB
PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
BDNF [HRP]
DBD00
N/A BDNF [HRP]
N/A BDNF [HRP]
N/A BDNF [HRP]
(104 Publications)
Species: Hu
Applications: ELISA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
EphA3 Antibody
[Unconjugated]
AF640
Immunohistochemistry EphA3 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
PRAK Antibody
NBP1-87231
Immunohistochemistry-Paraffin PRAK Antibody
Immunohistochemistry-Paraffin PRAK Antibody
Immunohistochemistry-Paraffin PRAK Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB

Publications for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP) (0)

There are no publications for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP) (0)

There are no reviews for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Kv1.3 Products

Research Areas for Kv1.3 Recombinant Protein Antigen (NBP2-48533PEP)

Find related products by research area.

Blogs on Kv1.3

There are no specific blogs for Kv1.3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Kv1.3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNA3