Kv1.1 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD |
Predicted Species |
Mouse (94%), Rat (91%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
KCNA1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, pH 7.2, 40% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Kv1.1 Antibody
Background
Kv1.1 belongs to a (Shaker) subfamily of the pota ium channel family. It is a major constituent of presynaptic A-type channels that modulate synaptic transmi ion in CNS neurons. Kv1.1-containing channels have been shown to be complexed with Lgi1, which is causative for an autosomal dominant form of lateral temporal lobe epilepsy. In the hippocampus Kv1.1 and Lgi1 are coa embled with Kv1.4 and Kv 1 in axonal terminals. Kv1.1 is an abundant Kv subunit in the brain that is found predominantly localized to axons and nerve terminals. Mutations in human Kv1.1 result in the dominant disorder Episodic Ataxia Type 1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, WB
Species: Ha, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
Publications for Kv1.1 Antibody (NBP3-17729) (0)
There are no publications for Kv1.1 Antibody (NBP3-17729).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Kv1.1 Antibody (NBP3-17729) (0)
There are no reviews for Kv1.1 Antibody (NBP3-17729).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Kv1.1 Antibody (NBP3-17729) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Kv1.1 Products
Research Areas for Kv1.1 Antibody (NBP3-17729)
Find related products by research area.
|
Blogs on Kv1.1