![Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Analysis in human testis and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Importin-11-Antibody-Immunohistochemistry-Paraffin-NBP2-49505-img0005.jpg "Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Analysis in human testis and skeletal muscle tissues. Corresponding RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QLLGNMIEMWVDRMDNITQPERRKLSALALLSLLPSDNSVIQDKFCGIINISVEGLHDVMTEDPETGTYKDCMLMSHLEEPKVTEDEEPPTEQD |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IPO11 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-49505 | Applications | Species |
|---|---|---|
| Walbrecq G, Lecha O, Gaigneaux A et Al. Hypoxia-Induced Adaptations of miRNomes and Proteomes in Melanoma Cells and Their Secreted Extracellular Vesicles Cancers (Basel) 2020-03-14 [PMID: 32183388] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Importin 11 Antibody (NBP2-49505)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IPO11 |
![Western Blot: Importin 11 Antibody [NBP2-49505] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG](http://images.novusbio.com/fullsize/Importin-11-Antibody-Western-Blot-NBP2-49505-img0003.jpg "Western Blot: Importin 11 Antibody [NBP2-49505] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG")
![Immunocytochemistry/Immunofluorescence: Importin 11 Antibody [NBP2-49505] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Importin-11-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49505-img0004.jpg "Immunocytochemistry/Immunofluorescence: Importin 11 Antibody [NBP2-49505] - Staining of human cell line CACO-2 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Importin-11-Antibody-Immunohistochemistry-NBP2-49505-img0009.jpg "Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Importin-11-Antibody-Immunohistochemistry-Paraffin-NBP2-49505-img0006.jpg "Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Importin-11-Antibody-Immunohistochemistry-Paraffin-NBP2-49505-img0007.jpg "Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/Importin-11-Antibody-Immunohistochemistry-Paraffin-NBP2-49505-img0008.jpg "Immunohistochemistry-Paraffin: Importin 11 Antibody [NBP2-49505] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")