Novus Biologicals products are now on bio-techne.com

IGFBP-rp1/IGFBP-7 Recombinant Protein Antigen

Images

 
There are currently no images for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

IGFBP-rp1/IGFBP-7 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGFBP7.

Source: E. coli

Amino Acid Sequence: EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IGFBP7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83415.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IGFBP-rp1/IGFBP-7 Recombinant Protein Antigen

  • angiomodulin
  • FSTL2
  • IBP-7
  • IGFBP7
  • IGFBP-7
  • IGFBP-7PGI2-stimulating factor
  • IGFBP-7v
  • IGFBPrp1
  • IGFBP-rp1
  • insulin-like growth factor binding protein 7
  • insulin-like growth factor-binding protein 7
  • MAC25 protein
  • Mac25
  • MAC25IGF-binding protein 7
  • Prostacyclin-stimulating factor
  • PSF
  • PSFAGM
  • TAF
  • Tumor-derived adhesion factor

Background

Observational study of gene-disease association. (HuGE Navigator. A genome-wide RNA-interference screening to identify genes required for an activated BRAF oncogene to block proliferation of fibroblasts and melanocytes revealed that a IGFBP7, has a central role in BRAF-mediated senescence and apoptosis. This study supports the role of IGFBP-1, -3 and -7 as potential tumour suppressor genes in human breast cancer. IGFBP7 plays a potential tumor suppressor role in colorectal carcinogenesis. Expression in tumor cells may reduce the anchorage-independent growth ability, leading to the marked loss of tumorigenicity. discovered the implication of insulin-like growth factor-binding protein-related protein 1 in endometrial physiology, which seems related to endometrial receptivity. data suggest that mac25/IGFBP-rP1 and 25.1 may play a functional role in the NE differentiation of NSCLC cell lines and may provide a novel therapeutic target for treating lung cancers, in particular NSCLC with NE differentiation. findings show for the first time that circulating IGF-binding protein (IGFBP)-related protein 1 (IGFBP-rP1) is increased with insulin resistance. that IGFBP-rP1 is an inhibitor of MCF-7 breast cancer cell proliferation and may act via a cellular senescence-like mechanism. IGFBP7 plays a potential tumor suppressor role against colorectal carcinogenesis and its expression is associated with DNA hypomethylation of exon 1. mRNA expression was lost in six out of eight CRC cell lines as compared to normal colon cells. DNA methylation was found in the region of exon 1 and intron 1 of IGFBP-7. tumor-suppressive activity is through induction of apoptosis in an IGF-I independent manner in prostate cancer. SOX9 contributes to growth regulation by mac25 via inhibition of cell growth and promotion of differentiation. In prostate cancer cells, one of the downstream mediators of the senescence-associated tumor suppression effect of mac25/IGFBP-rP1 is superoxide dismutase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB100-1556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
291-G1
Species: Hu
Applications: BA
NBP2-20329
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
292-G2
Species: Hu
Applications: BA
DGB300
Species: Hu
Applications: ELISA
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY871
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-80706
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP) (0)

There are no publications for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP) (0)

There are no reviews for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IGFBP-rp1/IGFBP-7 Products

Research Areas for IGFBP-rp1/IGFBP-7 Protein (NBP1-83415PEP)

Find related products by research area.

Blogs on IGFBP-rp1/IGFBP-7

There are no specific blogs for IGFBP-rp1/IGFBP-7, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IGFBP-rp1/IGFBP-7 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IGFBP7