Novus Biologicals products are now on bio-techne.com

Hsp70 interacting protein HIP Recombinant Protein Antigen

Name: Hsp70 interacting protein HIP Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-47427PEP
Price: 279 USD

Submit a Review

Images

There are currently no images for Hsp70 interacting protein HIP Protein (NBP2-47427PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Hsp70 interacting protein HIP Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ST13. Source: E. coli Amino Acid Sequence: PGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKYQSNPKVMNLISKLSAKFGGQA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ST13
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47427. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Hsp70 interacting protein HIP Recombinant Protein Antigen

AAG2
aging-associated protein 2
FAM10A1FAM10A4
heat shock 70kD protein binding protein
Hip
HIPFLJ27260
HOP
hsc70-interacting protein
Hsp70-interacting protein
HSPABP1
P48MGC129952
PRO0786
Progesterone receptor-associated p48 protein
Protein FAM10A1
Putative tumor suppressor ST13
Renal carcinoma antigen NY-REN-33
SNC6HSPABP
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein)
suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein)
Suppression of tumorigenicity 13 protein

Background

Hsp70 interacting protein HIP is encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HspA4 Antibody

NBP1-81696

Immunohistochemistry-Paraffin HspA4 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HSP90 alpha
Antibody

NB120-2928

Immunohistochemistry-Paraffin HSP90 alpha Antibody

(13 Publications)

Species: Hu, Mu, Pm, Rb, Rt, Sh

Applications: ICC/IF, IHC, IHC-P, IP, WB

ATP Citrate Lyase
Antibody

NBP1-90267

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

STI1 Antibody
(2E11)

H00010963-M35

Immunocytochemistry/ Immunofluorescence STI1 Antibody (2E11)

Immunohistochemistry-Paraffin STI1 Antibody (2E11)

(4 Publications)

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, S-ELISA, WB

CHIP/STUB1
Antibody (JG38-22)

NBP2-75440

Immunocytochemistry/ Immunofluorescence CHIP/STUB1 Antibody (JG38-22)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

IRF9 Antibody

NBP2-16991

Immunohistochemistry-Paraffin IRF9 Antibody

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

HSPA8/HSC71/Hsc70
Antibody (13D3)

NB120-2788

(2 Reviews)

(28 Publications)

Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt

Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB

IFN-alpha 1
Antibody

NBP2-75930

Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

p23/PTGES3
Antibody (JJ3)

NB300-576

(8 Publications)

Species: Ch, Gp, Hu, Mu, Pm, Rb, Rt, Xp

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

HSP40/DNAJB1
Antibody (OTI1F9)

NBP2-03433

Immunocytochemistry/ Immunofluorescence HSP40/DNAJB1 Antibody (OTI1F9)

Immunohistochemistry-Paraffin HSP40/DNAJB1 Antibody (OTI1F9)

Species: Ca, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CDK5 Activator 1
Antibody

NBP3-13279

Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Reg3A Antibody

NBP2-24763

Immunohistochemistry-Paraffin Reg3A Antibody

(3 Publications)

Species: Hu, Pm

Applications: IHC, IHC-P, WB

TPT1/TCTP Antibody
(2A3)

H00007178-M06

(4 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, WB

Tmp21/p23 Antibody
- BSA Free

NB110-57586

Western Blot Tmp21/p23 Antibody - BSA Free

Immunohistochemistry Tmp21/p23 Antibody - BSA Free

Species: Bv, Ch, Hu, Mu, Pm, Rb, Rt

Applications: IHC, IHC-P, KD, WB

RRAS Antibody

NB100-56161

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, IP, WB

STAT1 [p Tyr701]
Antibody [Unconjugate ...

AF2894

Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]

Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]

(1 Review)

(11 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICFlow, Simple Western, WB

STAT2 [p Tyr690]
Antibody (1021D) [Unc ...

MAB2890

Flow Cytometry STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]

Western Blot STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]

(3 Publications)

Species: Hu

Applications: Flow, Simple Western, WB

Dystrophin Antibody

NBP1-89953

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

RPL29 Antibody

NBP3-12600

Immunohistochemistry-Paraffin RPL29 Antibody

Species: Hu

Applications: ICC/IF, IHC-P, IP, WB

Bestrophin 1
Antibody (E6-6) - BSA

NB300-164

Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free

(1 Review)

(49 Publications)

Species: Ca, Hu, Mu, Po, Pm, Rt(-)

Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB

Publications for Hsp70 interacting protein HIP Protein (NBP2-47427PEP) (0)

There are no publications for Hsp70 interacting protein HIP Protein (NBP2-47427PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hsp70 interacting protein HIP Protein (NBP2-47427PEP) (0)

There are no reviews for Hsp70 interacting protein HIP Protein (NBP2-47427PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Hsp70 interacting protein HIP Protein (NBP2-47427PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Hsp70 interacting protein HIP Products

Research Areas for Hsp70 interacting protein HIP Protein (NBP2-47427PEP)

Find related products by research area.

Membrane Trafficking and Chaperones

Blogs on Hsp70 interacting protein HIP

There are no specific blogs for Hsp70 interacting protein HIP, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Bestrophin 1 Antibody (E6-6) - BSA Free
NB300-164

Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a HSP70 monoclonal antibody at a dilution of 1:50 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.

HSPA8/HSC71/Hsc70 Antibody (13D3)
NB120-2788

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Hsp70 interacting protein HIP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ST13

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Hsp70 interacting protein HIP Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Hsp70 interacting protein HIP Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Hsp70 interacting protein HIP Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Hsp70 interacting protein HIP Protein (NBP2-47427PEP) (0)

Reviews for Hsp70 interacting protein HIP Protein (NBP2-47427PEP) (0)

FAQs for Hsp70 interacting protein HIP Protein (NBP2-47427PEP) (0)

Additional Hsp70 interacting protein HIP Products

Research Areas for Hsp70 interacting protein HIP Protein (NBP2-47427PEP)

Blogs on Hsp70 interacting protein HIP

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics