Novus Biologicals products are now on bio-techne.com

HSD17B12 Antibody (4G11)

Name: HSD17B12 Antibody (4G11)
Brand: Novus Biologicals
SKU: H00051144-M08
Price: 519 USD

Submit a Review

Images

(

Enlarge)

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in NIH/3T3.

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in PC-12.

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in Jurkat (Cat # L017V1).

Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in human ovarian cancer.

Sandwich ELISA: HSD17B12 Antibody (4G11) [H00051144-M08] - Detection limit for recombinant GST tagged HSD17B12 is 0.3 ng/ml as a capture antibody.

Product Details

Summary

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, ELISA
Clone	4G11
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HSD17B12 Antibody (4G11) Summary

Immunogen	HSD17B12 (NP_057226, 203 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SATKTFVDFFSQCLHEEYRSKGVFVQSVLPYFVATKLAKIRKPTLDKPSPETFVKSAIKTVGLQSRTNG
Specificity	Reacts with hydroxysteroid (17-beta) dehydrogenase 12.
Isotype	IgG2b Kappa
Clonality	Monoclonal
Host	Mouse
Gene	HSD17B12
Purity	Protein A purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Sandwich ELISA Western Blot
Application Notes	This antibody is reactive against cell lysate for western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD17B12 Antibody (4G11)

17-beta-HSD 12
17-beta-hydroxysteroid dehydrogenase 12
EC 1.1.1.62,3-ketoacyl-CoA reductase
EC 1.3.1.-
hydroxysteroid (17-beta) dehydrogenase 12,17beta-HSD type 12
KARestradiol 17-beta-dehydrogenase 12
SDR12C1
short chain dehydrogenase/reductase family 12C, member 1
steroid dehydrogenase homolog

Background

The enzyme 17-beta hydroxysteroid dehydrogenase-12 (HSD17B12) uses NADPH to reduce 3-ketoacyl-CoA to 3-hydroxyacyl-CoA during the second step of fatty acid elongation.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glutamate Receptor
6 Antibody (4B4L9)

NBP3-16867

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, WB

GluR5/GRIK1
Antibody - BSA Free

NBP1-76850

Immunohistochemistry GluR5/GRIK1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

KA1/GRIK4/Glutamate Re ...

NBP1-76851

Immunohistochemistry KA1/GRIK4/Glutamate Receptor KA1 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Carbonic Anhydrase
III/CA3 Antibody (4A1 ...

H00000761-M02

Immunohistochemistry-Paraffin Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

Sandwich ELISA Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)

(5 Publications)

Species: Hu, Mu

Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB

KA2/GRIK5/Glutamate Re ...

NBP1-76853

Immunocytochemistry/ Immunofluorescence KA2/GRIK5/Glutamate Receptor KA2 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Carbonic Anhydrase
I/CA1 Antibody

NBP1-88191

Immunohistochemistry-Paraffin Carbonic Anhydrase I/CA1 Antibody

(3 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

GluR7/GRIK3
Antibody (2B3D1) - BS

NBP2-61782

Immunocytochemistry/ Immunofluorescence GluR7/GRIK3 Antibody (2B3D1) - BSA Free

Species: Hu

Applications: ELISA, ICC/IF, WB

KIR3DL1 Antibody
(DX9) [Unconjugated]

MAB1225

(5 Publications)

Species: Hu

Applications: Block, CyTOF-reported, Flow

GEM Antibody

NBP1-58906

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

PRRT2 Antibody -
BSA Free

NBP2-82026

Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free

Immunohistochemistry PRRT2 Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

GluR2 Antibody
(JU20-43)

NBP2-75510

Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

CD94 Antibody
(131412) [Unconjugate

MAB1058

(4 Publications)

Species: Hu

Applications: Block, CyTOF-ready, Flow

17
beta-HSD1/HSD17B1 Ant ...

AF7178

Immunohistochemistry 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]

Simple Western 17 beta-HSD1/HSD17B1 Antibody [Unconjugated]

Species: Hu

Applications: IHC, Simple Western, WB

KIR2DL3/CD158b2
Antibody (180701) [Un ...

MAB2014

(12 Publications)

Species: Hu

Applications: CyTOF-reported, Flow

NETO1 Antibody -
BSA Free

NBP2-41134

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Aldo-keto
Reductase 1C3/AKR1C3

7678-DH

(1 Review)

(1 Publication)

Species: Hu

Applications: EnzAct

mGluR7 Antibody -
BSA Free

NLS921

Species: Bv, Hu

Applications: ICC, IHC, IHC-P, WB

Glutathione
Reductase Antibody

NBP2-16684

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

HSD17B3 Antibody

NBP2-16884

Immunocytochemistry/ Immunofluorescence HSD17B3 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HSD17B12 Antibody
(4G11)

H00051144-M08

Species: Hu, Mu, Rt

Applications: WB, ELISA

Publications for HSD17B12 Antibody (H00051144-M08) (0)

There are no publications for HSD17B12 Antibody (H00051144-M08).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B12 Antibody (H00051144-M08) (0)

There are no reviews for HSD17B12 Antibody (H00051144-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B12 Antibody (H00051144-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional HSD17B12 Products

Research Areas for HSD17B12 Antibody (H00051144-M08)

Find related products by research area.

Blogs on HSD17B12

There are no specific blogs for HSD17B12, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our HSD17B12 Antibody (4G11) and receive a gift card or discount.

Bioinformatics

Gene Symbol	HSD17B12
Entrez	51144(Human)
Uniprot	NP_057226(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HSD17B12 Antibody (4G11)

Species Glossary

Images

Product Details

Order Details

HSD17B12 Antibody (4G11) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for HSD17B12 Antibody (4G11)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HSD17B12 Antibody (H00051144-M08) (0)

Reviews for HSD17B12 Antibody (H00051144-M08) (0)

Product General Protocols

Video Protocols

FAQs for HSD17B12 Antibody (H00051144-M08) (0)

Secondary Antibodies

Isotype Controls

Additional HSD17B12 Products

Research Areas for HSD17B12 Antibody (H00051144-M08)

Blogs on HSD17B12

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics