Home » HIF-3 alpha » HIF-3 alpha Proteins » HIF-3 alpha Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HIF-3 alpha Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HIF-3 alpha Protein (NBP1-89977PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HIF-3 alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HIF3A.

Source: E. coli

Amino Acid Sequence: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HIF3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89977.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HIF-3 alpha Recombinant Protein Antigen

  • Basic-helix-loop-helix-PAS protein MOP7
  • BHLHe17
  • bHLHe17HIF-3A2
  • Class E basic helix-loop-helix protein 17
  • HIF-3 alpha
  • HIF3A
  • HIF-3A4
  • HIF-3-alpha
  • HIF3-alpha
  • hypoxia inducible factor 3, alpha subunit
  • hypoxia-inducible factor 3-alpha
  • hypoxia-inducible factor-3 alpha 4
  • Inhibitory PAS domain protein
  • IPAS
  • IPASHIF3-alpha-1
  • Member of PAS protein 7
  • MOP7
  • MOP7PAS domain-containing protein 7
  • PASD7
  • PASD7HIF-3A

Background

Hypoxia-inducible factor (HIF) is one of the most important factors in the cellular response to hypoxia, by transcriptionally activating genes encoding proteins that mediate adaptive responses to reduced oxygen availability. HIF is a heterodimer consisting of one of three subunits, HIF1 alpha, HIF2 alpha, or HIF3 alpha. HIF target genes play critical roles in metabolism, angiogenesis, cell proliferation and cell survival. HIF3 alpha protein is one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha 3 subunit lacks the transactivation domain found in factors containing either the alpha 1 or alpha 2 subunits. HIF3 alpha may be a marker for tumor growth and angiogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1040 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
ARNT/HIF-1 beta
Antibody (H1beta234) ...
NB100-124
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Immunocytochemistry/ Immunofluorescence ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
(4 Reviews)
(106 Publications)
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Western Blot HIF-2 alpha/EPAS1 Antibody - BSA Free
(37 Reviews)
(823 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
HYPB Antibody -
Azide and BSA Free
NBP3-03807
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HYPB Antibody - Azide and BSA Free
Western Blot HYPB Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB
SIM2 Antibody
NBP1-68864
Western Blot SIM2 Antibody
(1 Publication)
Species: Mu
Applications: PEP-ELISA, WB
Von Hippel Lindau
Antibody (OTI1E1)
NBP2-45411
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(230 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
BCL-W/BCL2L2
Antibody (4G12E6) - B ...
NBP2-61706
ELISA BCL-W/BCL2L2 Antibody (4G12E6) - BSA Free
Flow Cytometry BCL-W/BCL2L2 Antibody (4G12E6) - BSA Free
Flow Cytometry BCL-W/BCL2L2 Antibody (4G12E6) - BSA Free
(1 Publication)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HIF-3 alpha
Antibody
NBP1-89977
Immunohistochemistry-Paraffin HIF-3 alpha Antibody
Immunohistochemistry-Paraffin HIF-3 alpha Antibody
Immunohistochemistry-Paraffin HIF-3 alpha Antibody
Species: Hu
Applications: IHC, IHC-P
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Mcl-1 Antibody
NB100-56146
Western Blot Mcl-1 Antibody
Immunohistochemistry-Paraffin Mcl-1 Antibody
(1 Review)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(815 Publications)
Species: Hu
Applications: BA
HIF-3 alpha
Recombinant Protein A
NBP1-89977PEP
HIF-3 alpha Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HIF-3 alpha Protein (NBP1-89977PEP) (0)

There are no publications for HIF-3 alpha Protein (NBP1-89977PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIF-3 alpha Protein (NBP1-89977PEP) (0)

There are no reviews for HIF-3 alpha Protein (NBP1-89977PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HIF-3 alpha Protein (NBP1-89977PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIF-3 alpha Products

Research Areas for HIF-3 alpha Protein (NBP1-89977PEP)

Find related products by research area.

Blogs on HIF-3 alpha.

Check out the latest blog posts on HIF-3 alpha.
HIF-2 alpha: HIF1A's Homologue with Similar and Divergent Functions
HIF-2 alpha is a member of the heterodimeric hypoxia-inducible factors/HIFs family (HIF-1, HIF-2, and HIF-3) which contains a common beta subunit but differ in their alpha subunits. Also called as EPAS1 or Mop2, HIF-2 alpha regulates cellular adapt...  Read full blog post.
HIF-3 alpha: a versatile target with hypoxia dependent and independent functions
By: Subhash GangarHIF-3 alpha (hypoxia-inducible factor 3-alpha/ HIF3A) represents an isoform of HIF-alpha subunits which heterodimerize with stable beta subunit (HIF-beta) for the regulation of HIF target genes through binding to hypoxia respon...  Read full blog post.
HIF Prolyl Hydroxylase 2: an important Oxygen Sensor Protein
Prolyl hydroxylase domain (PHD) proteins, including PHD1, PHD2, and PHD3, mediate oxygen-dependent degradation of hypoxia-inducible factor (HIF) alpha subunits. Suppression of PHD enzymes leads to stabilization of HIFs and offers a potential treatment...  Read full blog post.
HIF Antibodies: Beyond HIF-1 alpha
The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the...  Read full blog post.
A Role for HIF-1 alpha Antibody in Renal Research
The Hypoxia Inducible Factors (HIFs) are a family of mammalian transcription factors which are expressed in response to low cellular oxygen concentrations (hypoxia). Three human hypoxia inducible factors have been identified, HIF-1, HIF-2 and HIF-3, e...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105
Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
HIF-2 alpha/EPAS1 Antibody - BSA Free
NB100-122

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HIF-3 alpha Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HIF3A