Home » HEY2 » HEY2 Proteins » HEY2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HEY2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HEY2 Recombinant Protein Antigen (NBP2-57809PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HEY2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEY2.

Source: E. coli

Amino Acid Sequence: PCEETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTTSQIMARKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HEY2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57809.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HEY2 Recombinant Protein Antigen

  • BHLHB32
  • bHLHb32HES-related repressor protein 2
  • cardiovascular basic helix-loop-helix factor 1
  • Cardiovascular helix-loop-helix factor 1
  • CHF1
  • Class B basic helix-loop-helix protein 32
  • GRLGRIDLOCK
  • Hairy and enhancer of split-related protein 2
  • hairy/enhancer-of-split related with YRPW motif 2
  • hairy/enhancer-of-split related with YRPW motif protein 2
  • Hairy-related transcription factor 2
  • hCHF1
  • HERP
  • HERP1hHRT2
  • HESR2
  • HESR-2
  • HES-related repressor protein 1
  • HRT2
  • HRT-2
  • MGC10720
  • Protein gridlock homolog

Background

The HEY2 gene encodes a member of the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix(bHLH)-type transcription factors. The encoded protein forms homo- or hetero-dimers that localize to the nucleus andinteract with a histone deacet

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HEY1 Antibody
NBP2-16818
Western Blot HEY1 Antibody
Immunohistochemistry-Frozen HEY1 Antibody
Immunocytochemistry/ Immunofluorescence HEY1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, WB
Notch-1 Antibody
(mN1A) - BSA Free
NB100-78486
Immunohistochemistry-Paraffin Notch-1 Antibody (mN1A) - BSA Free
Knockout Validated Notch-1 Antibody (mN1A) - BSA Free
Flow Cytometry Notch-1 Antibody (mN1A) - BSA Free
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
Immunocytochemistry/ Immunofluorescence HES-1 Antibody (OTI4H1)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
HERPUD1 Antibody
(OTI1A2)
NBP2-45970
Immunocytochemistry/ Immunofluorescence HERPUD1 Antibody (OTI1A2)
Immunohistochemistry HERPUD1 Antibody (OTI1A2)
Immunohistochemistry HERPUD1 Antibody (OTI1A2)
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Notch-4 Antibody
[Unconjugated]
AF3847
Immunocytochemistry Notch-4 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
Hey L Antibody
(1F6)
H00026508-M07
ELISA Hey L Antibody (1F6)
Immunocytochemistry/ Immunofluorescence Hey L Antibody (1F6)
Immunohistochemistry-Paraffin Hey L Antibody (1F6)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
csl/RBPJK Antibody
NBP1-33427
Chromatin Immunoprecipitation (ChIP) csl/RBPJK Antibody
Immunocytochemistry/ Immunofluorescence csl/RBPJK Antibody
Western Blot csl/RBPJK Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ChIP, ICC/IF, WB
GRP78/HSPA5
Antibody - BSA Free
NBP1-06274
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Flow Cytometry GRP78/HSPA5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free
(2 Reviews)
(43 Publications)
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
RNF7 Antibody
NBP1-85594
Western Blot RNF7 Antibody
Immunocytochemistry/ Immunofluorescence RNF7 Antibody
Immunohistochemistry-Paraffin RNF7 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DLL4 Antibody
[Unconjugated]
AF1389
Western Blot DLL4 Antibody [Unconjugated]
Immunocytochemistry DLL4 Antibody [Unconjugated]
Immunohistochemistry DLL4 Antibody [Unconjugated]
(1 Review)
(63 Publications)
Species: Mu
Applications: ICC, IHC, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
Notch-3 Antibody
(1G5)
H00004854-M01
ELISA Notch-3 Antibody (1G5)
(1 Review)
(13 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Notch-2 Antibody
[Unconjugated]
AF3735
Immunohistochemistry Notch-2 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
HES5 Antibody -
BSA Free
NBP2-41305
Immunocytochemistry/ Immunofluorescence HES5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence HES5 Antibody - BSA Free
Immunohistochemistry HES5 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(45 Publications)
Species: Hu
Applications: BA
GATA-4 Antibody -
BSA Free
NBP2-24585
Immunohistochemistry-Paraffin GATA-4 Antibody - BSA Free
Western Blot GATA-4 Antibody - BSA Free
Immunohistochemistry-Paraffin GATA-4 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
RRBP1 Antibody
NBP1-83957
Immunocytochemistry/ Immunofluorescence RRBP1 Antibody
Immunohistochemistry-Paraffin RRBP1 Antibody
Immunohistochemistry-Paraffin RRBP1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for HEY2 Recombinant Protein Antigen (NBP2-57809PEP) (0)

There are no publications for HEY2 Recombinant Protein Antigen (NBP2-57809PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEY2 Recombinant Protein Antigen (NBP2-57809PEP) (0)

There are no reviews for HEY2 Recombinant Protein Antigen (NBP2-57809PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HEY2 Recombinant Protein Antigen (NBP2-57809PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HEY2 Products

Research Areas for HEY2 Recombinant Protein Antigen (NBP2-57809PEP)

Find related products by research area.

Blogs on HEY2

There are no specific blogs for HEY2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of bEnd.3 mouse endothelioma cell line. PVDF membrane was probed with 2 µg/mL of Goat Anti-Mouse DLL4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1389) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for DLL4 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
DLL4 Antibody [Unconjugated]
AF1389

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HEY2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HEY2