We will want to use this full-length protein, but we will also want to use the protein with the GST tag removed. How can we remove the tag from this sequence?

Name: Recombinant Human HE4/WFDC2 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00010406-P01
Price: 569 USD

Question

Accepted Answer

This is a product we distribute for a Taiwanese company called Abnova. Here is a link, provided by Abnova, to the  protocol for removing the GST tag from the full length protein.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Description	A recombinant protein with GST tag at N-terminal corresponding to the amino acids 31-124 of Human WFDC2 Source: Wheat Germ (in vitro) Amino Acid Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	WFDC2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Publications using H00010406-P01	Applications	Species
Eaton RM, Shallcross JA, Mael LE et al. Selection of DNA aptamers for ovarian cancer biomarker HE4 using CE-SELEX and high-throughput sequencing. Anal Bioanal Chem. 2015-04-12 [PMID: 25863801]
Townes CL, Ali A, Gross N et al. Prostate specific antigen enhances the innate defence of prostatic epithelium against Escherichia coli infection. Prostate 2013-07-01 [PMID: 23818154] (WB)	WB

Recombinant Human HE4/WFDC2 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human HE4/WFDC2 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human HE4/WFDC2 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HE4/WFDC2 Recombinant Protein (H00010406-P01)(2)

Reviews for HE4/WFDC2 Recombinant Protein (H00010406-P01) (0)

Product General Protocols

Video Protocols

FAQs for HE4/WFDC2 Recombinant Protein (H00010406-P01). (Showing 1 - 2 of 2 FAQs).

Additional HE4/WFDC2 Products

Research Areas for HE4/WFDC2 Recombinant Protein (H00010406-P01)

Blogs on HE4/WFDC2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics