Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, ICC/IF |
Clone | 3D5 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | HCLS1 (AAH16758, 266 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE |
Specificity | HCLS1 - hematopoietic cell-specific Lyn substrate 1 |
Isotype | IgG1 Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | HCLS1 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00003059-M01 | Applications | Species |
---|---|---|
Kan CY, Wen VW, Pasquier E et al. Endothelial cell dysfunction and cytoskeletal changes associated with repression of p16(INK4a) during immortalization. Oncogene. 2012-02-06 [PMID: 22310292] |
Secondary Antibodies |
Isotype Controls |
Research Areas for HCLS1 Antibody (H00003059-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.