![Western Blot: GRAF Antibody [NBP1-89732] - Analysis in human cell lines Caco-2 and MCF-7 using anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/GRAF-Antibody-Western-Blot-NBP1-89732-img0012.jpg "Western Blot: GRAF Antibody [NBP1-89732] - Analysis in human cell lines Caco-2 and MCF-7 using anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HLSRKKSSDSKPPSCSERPLTLFHTVQSTEKQEQRNSIINSSLESVSSNPNSILNSSSSLQPNMNSSDPDLAVVKPTRPNSLPPNPSPTS |
| Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ARHGAP26 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID:31690048). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GRAF Antibody (NBP1-89732)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: GRAF Antibody [NBP1-89732] - Jurkat T cells expressing GFP-Cdc42-Q61L, activated, fixed and stained with an antibody against endogenous GRAF. Arrows indicate GRAF-positive tubules. Images representative of at least three independent experiments. Scale bar: 5 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31690048/) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/GRAF-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89732-img0013.jpg "Immunocytochemistry/Immunofluorescence: GRAF Antibody [NBP1-89732] - Jurkat T cells expressing GFP-Cdc42-Q61L, activated, fixed and stained with an antibody against endogenous GRAF. Arrows indicate GRAF-positive tubules. Images representative of at least three independent experiments. Scale bar: 5 um. Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31690048/) licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining in human cerebral cortex and pancreas tissues using anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/GRAF-Antibody-Immunohistochemistry-Paraffin-NBP1-89732-img0010.jpg "Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining in human cerebral cortex and pancreas tissues using anti-ARHGAP26 antibody. Corresponding ARHGAP26 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/GRAF-Antibody-Immunohistochemistry-Paraffin-NBP1-89732-img0008.jpg "Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/GRAF-Antibody-Immunohistochemistry-Paraffin-NBP1-89732-img0009.jpg "Immunohistochemistry-Paraffin: GRAF Antibody [NBP1-89732] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Immunohistochemistry_10745.jpg)
![Western Blot FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Western_Blot_6185.jpg)
![Knockout Validated FAK Antibody (495919) [Unconjugated]](https://images.novusbio.com/images2/FAK_MAB4467_Knockout_Validated_22784.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![FXR/NR1H4 Antibody (A9033A) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FXR/NR1H4 Antibody (A9033A) [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")