Novus Biologicals products are now on bio-techne.com

GPR64 Recombinant Protein Antigen

Name: GPR64 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84906PEP
Price: 279 USD

Images

There are currently no images for GPR64 Protein (NBP1-84906PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GPR64 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GPR64. Source: E. coli Amino Acid Sequence: SPTVSAPANVNTTSAPPVQTDIVNTSSISDLENQVLQMEKALSLGSLEPNLAGEMINQVSRLLHSPPDMLAPLAQRLLKVVDDIGLQLNFSNTTISLTSPSLALAVIRVNASSFNTTTFVAQDPANLQVSLETQAPE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ADGRG2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84906. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GPR64 Recombinant Protein Antigen

EDDM6
epididymis-specific (seven transmembrane family)
G protein-coupled receptor 64
GPR64
HE6
MGC104454
MGC138738
TM7LN2

Background

GPR64 is an Orphan-B GPCR with an unknown ligand. HE6 is endogenously cleaved into two pieces at the GPCR proteolytic site (GPS) located adjacent to the first transmembrane helix as a mechanism to compartmentalize the cell adhesion and GPCR activation functions. GPR64 has been reported in the epididymis. ESTs have been isolated from embryo, kidney, placenta, skeletal muscle, and testis libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GPR151 Antibody -
BSA Free

NLS418

Species: Hu

Applications: IHC, IHC-P

MRGX1 Antibody -
BSA Free

NLS2756

Species: Hu, Pm

Applications: ICC, IHC, IHC-P

GPR56 Antibody
[Unconjugated]

AF4634

Simple Western GPR56 Antibody [Unconjugated]

Flow Cytometry GPR56 Antibody [Unconjugated]

(4 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, Simple Western, WB

Lgr6 Antibody
(918719) [Unconjugate

MAB8458

Immunocytochemistry Lgr6 Antibody (918719) [Unconjugated]

(1 Publication)

Species: Hu

Applications: CyTOF-ready, Flow, ICC

LPAR3/LPA3/EDG-7
Antibody - BSA Free

NLS1017

Species: Bt, Bv, Ca, Eq, Hu, Mu

Applications: IHC, IHC-P

Frizzled-4
Antibody (145901)

MAB194

(1 Review)

(7 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC, WB

GPRC6A Antibody -
BSA Free

NLS2576

(3 Publications)

Species: Hu, Pm, Rt

Applications: IHC, IHC-P

Clusterin/APOJ
Antibody [Unconjugate

AF2747

Western Blot Clusterin/APOJ Antibody [Unconjugated]

(13 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

ENPP-2/Autotaxin
[Unconjugated]

5255-EN

(5 Publications)

Species: Hu

Applications: EnzAct

Osteopontin/OPN
Antibody [Unconjugate

AF808

Neutralization Osteopontin/OPN Antibody [Unconjugated]

Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]

(2 Reviews)

(208 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB

VIP Antibody
(OTI1E8)

NBP2-46349

Species: Hu

Applications: IHC, IHC-P, WB

RGS4 Antibody
(HL1522) - Azide and ...

NBP3-25636

Immunocytochemistry/ Immunofluorescence RGS4 Antibody (HL1522) - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

CD52 Antibody
(Campath-1H) - Chimer ...

NBP2-52645

Immunohistochemistry CD52 Antibody (Campath-1H) - Chimeric - Azide and BSA Free

Species: Pm-Cm, Hu, RM

Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vivo, WB

GPR125 Antibody

NBP1-03561

(1 Review)

(3 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, PEP-ELISA, WB

Secretin Antibody

NBP3-41177

Species: Mu

Applications: ICC/IF, IHC, WB

GPR64 Recombinant
Protein Antigen

NBP1-84906PEP

Species: Hu

Applications: AC

Publications for GPR64 Protein (NBP1-84906PEP) (0)

There are no publications for GPR64 Protein (NBP1-84906PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GPR64 Protein (NBP1-84906PEP) (0)

There are no reviews for GPR64 Protein (NBP1-84906PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GPR64 Protein (NBP1-84906PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GPR64 Products

Research Areas for GPR64 Protein (NBP1-84906PEP)

Find related products by research area.

GPCR

Blogs on GPR64

There are no specific blogs for GPR64, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.

Osteopontin/OPN Antibody [Unconjugated]
AF808

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our GPR64 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ADGRG2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

GPR64 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

GPR64 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for GPR64 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for GPR64 Protein (NBP1-84906PEP) (0)

Reviews for GPR64 Protein (NBP1-84906PEP) (0)

FAQs for GPR64 Protein (NBP1-84906PEP) (0)

Additional GPR64 Products

Research Areas for GPR64 Protein (NBP1-84906PEP)

Blogs on GPR64

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics