Home » Glutathione Reductase » Glutathione Reductase Proteins » Glutathione Reductase Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Glutathione Reductase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Glutathione Reductase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glutathione Reductase

Source: E. coli

Amino Acid Sequence: SALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GSR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17718.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glutathione Reductase Recombinant Protein Antigen

  • EC 1.8.1
  • EC 1.8.1.7
  • GLUR
  • Glutathione Reductase
  • glutathione reductase, mitochondrial
  • GR
  • GRase
  • GRD1
  • GSR
  • HEL-752
  • MGC78522

Background

Glutathione reductase (GR) is a member of pyridine nucleotide-disulfideoxidoreductases, which includes the closely related enzymes thioredoxin reductase, lipoamide dehydrogenase, trypanothione reductase and mercuric ion reductase. GR is a cytoplasmic flavoenzyme widely distributed in aerobic organisms. The dimeric protein is composed of two identical subunits, each containing 1 FAD and 1 redox-active disulfide/dithiol as components of the catalytic apparatus. It plays a role in maintaining glutathione(GSH) in its reduced form by catalyzing the reduction of glutathione disulfide (GSSG): GSSG + NADPH + H+ ->2GSH + NADP+. In mosteukaryotic cells, GR maintains the ratio of [GSH]/[GSSG], and participates in several vital functions such as the detoxification of reactive oxygen species as well as protein and DNA biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Flow Cytometry GR/NR3C1 Antibody (BuGR2) - BSA Free
Immunocytochemistry/ Immunofluorescence GR/NR3C1 Antibody (BuGR2) - BSA Free
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Glutathione S
Transferase kappa 1 A ...
NBP2-16686
Western Blot Glutathione S Transferase kappa 1 Antibody
Western Blot Glutathione S Transferase kappa 1 Antibody
Immunohistochemistry-Paraffin Glutathione S Transferase kappa 1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
SLCO6A1 Antibody
NBP2-49118
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Immunohistochemistry-Paraffin SLCO6A1 Antibody
Species: Hu
Applications: IHC, IHC-P
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Mineralocorticoid
R/NR3C2 Antibody (H10 ...
NB300-562
Immunohistochemistry-Paraffin Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
Western Blot Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
Immunocytochemistry/ Immunofluorescence Mineralocorticoid R/NR3C2 Antibody (H10E4C9F) - BSA Free
(2 Publications)
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Lactoperoxidase
Antibody - BSA Free
NB110-61574
Western Blot Lactoperoxidase Antibody - BSA Free
Species: Bv, Gt, Hu, Mu, Sh
Applications: WB
APE Antibody
(13B8E5C2) - BSA Free
NB100-116
Immunocytochemistry/ Immunofluorescence APE Antibody (13B8E5C2) - BSA Free
Western Blot APE Antibody (13B8E5C2) - BSA Free
Chromatin Immunoprecipitation (ChIP) APE Antibody (13B8E5C2) - BSA Free
(3 Reviews)
(107 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Heparanase/HPSE
[Unconjugated]
7570-GH
Enzyme Activity Heparanase/HPSE [Unconjugated]
SDS-PAGE Heparanase/HPSE [Unconjugated]
(13 Publications)
Species: Hu
Applications: EnzAct
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Glutathione
Reductase Recombinant ...
NBP3-17718PEP
Glutathione Reductase Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP) (0)

There are no publications for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP) (0)

There are no reviews for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutathione Reductase Products

Research Areas for Glutathione Reductase Recombinant Protein Antigen (NBP3-17718PEP)

Find related products by research area.

Blogs on Glutathione Reductase

There are no specific blogs for Glutathione Reductase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Immunocytochemistry/Immunofluorescence: APE Antibody (13B8E5C2) - BSA Free [NB100-116] - APE Antibody (13B8E5C2) [NB100-116] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton X-100. The cells were incubated with anti-APE (13B8E5C2) at 5 ug/mL overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
APE Antibody (13B8E5C2) - BSA Free
NB100-116

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glutathione Reductase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GSR