Home » Gastric Lipase » Gastric Lipase Proteins » Gastric Lipase Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Gastric Lipase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Gastric Lipase Protein (NBP1-91928PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Gastric Lipase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LIPF.

Source: E. coli

Amino Acid Sequence: GGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
LIPF
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91928.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gastric Lipase Recombinant Protein Antigen

  • EC 3.1.1
  • EC 3.1.1.3
  • Gastric Lipase
  • gastric triacylglycerol lipase
  • GL
  • HGL
  • HLAL
  • lipase, gastric
  • LIPF
  • MGC138477
  • MGC142271

Background

Gastric Lipase encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot G protein alpha inhibitor 1 Antibody (2B8-2A5)
Immunohistochemistry-Paraffin G protein alpha inhibitor 1 Antibody (2B8-2A5)
Sandwich ELISA G protein alpha inhibitor 1 Antibody (2B8-2A5)
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Pancreatic Lipase
Antibody
NBP2-38958
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Immunohistochemistry-Paraffin Pancreatic Lipase Antibody
Species: Hu
Applications: IHC, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot GLS2 Antibody - BSA Free
Immunohistochemistry GLS2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GLS2 Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
PPP1R3A Antibody
NBP3-17131
Immunohistochemistry-Paraffin PPP1R3A Antibody
Immunohistochemistry-Paraffin PPP1R3A Antibody
Immunohistochemistry-Paraffin PPP1R3A Antibody
Species: Hu
Applications: IHC, IHC-P
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Species: Hu
Applications: IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

beta-Glucuronidase/GUS
NBP1-87511
Immunocytochemistry/ Immunofluorescence beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Carboxyl Ester
Lipase/CEL Antibody
NBP1-88502
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Immunohistochemistry-Paraffin Carboxyl Ester Lipase/CEL Antibody
Species: Hu
Applications: IHC, IHC-P
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(845 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(664 Publications)
Species: Mu
Applications: ELISA
APC Antibody - BSA
Free
NB100-91662
Immunocytochemistry/ Immunofluorescence APC Antibody - BSA Free
Flow Cytometry APC Antibody - BSA Free
Immunohistochemistry-Paraffin APC Antibody - BSA Free
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Gastric Lipase
Recombinant Protein A ...
NBP1-91928PEP
Gastric Lipase Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Gastric Lipase Protein (NBP1-91928PEP) (0)

There are no publications for Gastric Lipase Protein (NBP1-91928PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastric Lipase Protein (NBP1-91928PEP) (0)

There are no reviews for Gastric Lipase Protein (NBP1-91928PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gastric Lipase Protein (NBP1-91928PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gastric Lipase Products

Research Areas for Gastric Lipase Protein (NBP1-91928PEP)

Find related products by research area.

Blogs on Gastric Lipase

There are no specific blogs for Gastric Lipase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gastric Lipase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol LIPF