![Western Blot: FTO Antibody (2Q9K10) [NBP3-16285] - Analysis of extracts of various cell lines, using FTO Rabbit mAb (NBP3-16285) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.](http://images.novusbio.com/fullsize/FTO-Antibody-2Q9K10-Western-Blot-NBP3-16285-img0003.jpg "Western Blot: FTO Antibody (2Q9K10) [NBP3-16285] - Analysis of extracts of various cell lines, using FTO Rabbit mAb (NBP3-16285) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clone | 2Q9K10 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FTO (Q9C0B1). MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEELHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIG |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | FTO |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Immunohistochemistry_12988.jpg)
![Intracellular Staining by Flow Cytometry ZnT-8/SLC30A8 Antibody (815039) [Unconjugated]](https://images.novusbio.com/images2/ZnT8_MAB7936_Flow_Cytometry_23901.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for FTO Antibody (NBP3-16285)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FTO |
![Immunocytochemistry/Immunofluorescence: FTO Antibody (2Q9K10) [NBP3-16285] - Immunofluorescence analysis of U-2 OS cells using FTO Rabbit mAb (NBP3-16285) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/FTO-Antibody-2Q9K10-Immunocytochemistry-Immunofluorescence-NBP3-16285-img0002.jpg "Immunocytochemistry/Immunofluorescence: FTO Antibody (2Q9K10) [NBP3-16285] - Immunofluorescence analysis of U-2 OS cells using FTO Rabbit mAb (NBP3-16285) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: FTO Antibody (2Q9K10) [NBP3-16285] - Human bladder cancer using FTO Rabbit mAb (NBP3-16285) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/FTO-Antibody-2Q9K10-Immunohistochemistry-Paraffin-NBP3-16285-img0001.jpg "Immunohistochemistry-Paraffin: FTO Antibody (2Q9K10) [NBP3-16285] - Human bladder cancer using FTO Rabbit mAb (NBP3-16285) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: FTO Antibody (2Q9K10) [NBP3-16285] - Analysis of 300ug extracts of 293T cells using 3ug FTO antibody (NBP3-16285). Western blot was performed from the immunoprecipitate using FTO antibody (NBP3-16285) at a dilition of 1:500.](http://images.novusbio.com/fullsize/FTO-Antibody-2Q9K10-Immunoprecipitation-NBP3-16285-img0004.jpg "Immunoprecipitation: FTO Antibody (2Q9K10) [NBP3-16285] - Analysis of 300ug extracts of 293T cells using 3ug FTO antibody (NBP3-16285). Western blot was performed from the immunoprecipitate using FTO antibody (NBP3-16285) at a dilition of 1:500.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images2/Leptin_R_AF497_Immunohistochemistry_6850.jpg)
![Western Blot Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-41202410481130.jpg)
![Immunohistochemistry Leptin R Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af497_mouse-leptin-r-affinity-purified-polyclonal-ab-immunohistochemistry-251120248493..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")