FGF-9 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGF9. Source: E. coli
Amino Acid Sequence: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
FGF9 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62653. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for FGF-9 Recombinant Protein Antigen
Background
The protein encoded by the FGF9 gene is a member of the fibroblast growth factor (FGF) family. FGF family members possessbroad mitogenic and cell survival activities, and are involved in a variety of biological processes, includingembryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolatedas a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, thisprotein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homologof this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed amale-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: BA, BA
Publications for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP) (0)
There are no publications for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP) (0)
There are no reviews for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP) (0)
Additional FGF-9 Products
Research Areas for FGF-9 Recombinant Protein Antigen (NBP2-62653PEP)
Find related products by research area.
|
Blogs on FGF-9