Home » Fc epsilon RI » Fc epsilon RI Proteins » Fc epsilon RI Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Fc epsilon RI Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Fc epsilon RI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Fc epsilon RI.

Source: E. coli

Amino Acid Sequence: VSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FCER1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-54974.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fc epsilon RI Recombinant Protein Antigen

  • alpha polypeptide
  • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
  • Fc-epsilon RI-alpha
  • FcERI
  • high affinity immunoglobulin epsilon receptor alpha-subunit
  • high affinity immunoglobulin epsilon receptor subunit alpha
  • high-affinity, of mast cells, alpha polypeptide

Background

The allergic reaction is mediated through the IgE high affinity receptor (FceRI). When a multivalent antigen is presented, a redistribution of the monomeric IgE FceRI receptor complexes cause the degranulation of mast cells and basophils, resulting in the subsequent release of factors responsible for the allergic reaction. The FceRI receptor is a tetrameric complex, consisting of a a-chain, b-chain and a dimeric g-chain. While the a-chain is primarily involved with the binding of IgE, the signal is transferred through the g subunit, which contains the immunoreceptor tyrosine activation motifs (ITAM) critical for initiating receptor mediated signal transduction through the Syk and Lyn tyrosine kinases. The FceRI receptor is able to engage and disengage the IgE, providing a versatile model for studying the function of kinase coupled receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IgE Antibody (1E7)
NBP3-11412
IgE Antibody (1E7)
(4 Publications)
Species: Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(145 Publications)
Species: Mu
Applications: ELISA
Fc epsilon RI
beta/MS4A2 Antibody
NBP2-31807
Immunohistochemistry-Paraffin Fc epsilon RI beta/MS4A2 Antibody
Immunohistochemistry-Paraffin Fc epsilon RI beta/MS4A2 Antibody
Immunohistochemistry-Paraffin Fc epsilon RI beta/MS4A2 Antibody
Species: Hu
Applications: IHC, IHC-P
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
STAT6 Antibody
(177C322.1) - BSA Fre
NBP2-25241
Western Blot STAT6 Antibody (177C322.1) - BSA Free
Immunocytochemistry/ Immunofluorescence STAT6 Antibody (177C322.1) - BSA Free
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
ENPP-3/CD203c
Antibody (NP4D6) - BS ...
NBP1-44643
Flow Cytometry ENPP-3/CD203c Antibody (NP4D6) - BSA Free
Immunocytochemistry/ Immunofluorescence ENPP-3/CD203c Antibody (NP4D6) - BSA Free
Flow Cytometry ENPP-3/CD203c Antibody (NP4D6) - BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
GATA-1 Antibody
(4F5) - BSA Free
NBP1-47492
Immunohistochemistry GATA-1 Antibody (4F5) - BSA Free
Immunocytochemistry/ Immunofluorescence GATA-1 Antibody (4F5) - BSA Free
Immunohistochemistry-Paraffin GATA-1 Antibody (4F5) - BSA Free
(1 Review)
(2 Publications)
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(66 Publications)
Species: Hu
Applications: ELISA
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(204 Publications)
Species: Hu
Applications: BA
Ephrin-A2
8415-A2
Ephrin-A2
Species: Mu
Applications: BA
FCER1G Antibody
(HL1418) - Azide and ...
NBP3-25463
Immunohistochemistry-Paraffin FCER1G Antibody (HL1418) - Azide and BSA Free
Immunohistochemistry-Paraffin FCER1G Antibody (HL1418) - Azide and BSA Free
Western Blot FCER1G Antibody (HL1418) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD23/Fc epsilon
RII Antibody [Unconju ...
AF123
Immunocytochemistry CD23/Fc epsilon RII Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: Block, ICC, WB

Publications for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP) (0)

There are no publications for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP) (0)

There are no reviews for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fc epsilon RI Products

Research Areas for Fc epsilon RI Recombinant Protein Antigen (NBP2-54974PEP)

Find related products by research area.

Blogs on Fc epsilon RI

There are no specific blogs for Fc epsilon RI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fc epsilon RI Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FCER1A