Home » Fc epsilon RI beta/MS4A2 » MS4A2 Peptides and Proteins » Recombinant Human Fc epsilon RI beta/MS4A2 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Fc epsilon RI beta/MS4A2 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
Recombinant Human Fc epsilon RI beta/MS4A2 Protein [H00002206-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human Fc epsilon RI beta/MS4A2 Protein [H00002206-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Fc epsilon RI beta/MS4A2 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-244 of Human MS4A2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSPPIDL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MS4A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
52.9 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fc epsilon RI beta/MS4A2 GST (N-Term) Protein

  • APY
  • ATOPY
  • Fc epsilon receptor I beta-chain
  • Fc epsilon RI beta
  • Fc epsilonRIb
  • FCER1B
  • FCER1BIGEL
  • FCERI
  • High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fcreceptor, beta-subunit) (Fc epsilon receptor I beta-chain)
  • high affinity immunoglobulin epsilon receptor subunit beta
  • IgE Fc receptor subunit beta
  • IgE responsiveness (atopic)
  • IGEL
  • IGER
  • IGHER
  • immunoglobulin E receptor, high affinity, beta polypeptide
  • Membrane-spanning 4-domains subfamily A member 2
  • membrane-spanning 4-domains, subfamily A, member 2 (Fc fragment of IgE, highaffinity I, receptor for; beta polypeptide)
  • MS4A1
  • MS4A2

Background

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of family members. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IgE Antibody (1E7)
NBP3-11412
IgE Antibody (1E7)
(5 Publications)
Species: Sh
Applications: ELISA, IHC, IHC-Fr, WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(149 Publications)
Species: Mu
Applications: ELISA
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
IL-4R alpha
[Unconjugated]
230-4RB
IL-4R alpha [Unconjugated]
(1 Publication)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
Fc epsilon RI
Antibody (AER-37) - B ...
NBP1-43278
Flow Cytometry Fc epsilon RI Antibody (AER-37) - BSA Free
Immunohistochemistry-Paraffin Fc epsilon RI Antibody (AER-37) - BSA Free
Flow Cytometry Fc epsilon RI Antibody (AER-37) - BSA Free
(2 Publications)
Species: Hu
Applications: Flow, IHC, IHC-P
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(217 Publications)
Species: Hu
Applications: BA
Serpin E1/PAI-1
Antibody - BSA Free
NBP1-19773
Western Blot Serpin E1/PAI-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Serpin E1/PAI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin E1/PAI-1 Antibody - BSA Free
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
MS4A3 Antibody
(489433)
MAB6247
Flow Cytometry MS4A3 Antibody (489433)
Species: Hu
Applications: CyTOF-ready, Flow
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
T-bet/TBX21
Antibody (525803) [Un ...
MAB5385
Western Blot T-bet/TBX21 Antibody (525803) [Unconjugated]
Intracellular Staining by Flow Cytometry T-bet/TBX21 Antibody (525803) [Unconjugated]
Intracellular Staining by Flow Cytometry T-bet/TBX21 Antibody (525803) [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, ICFlow, WB
LTC4S Antibody
NBP1-69315
Western Blot LTC4S Antibody
Western Blot LTC4S Antibody
Species: Hu
Applications: WB

Publications for Fc epsilon RI beta/MS4A2 Recombinant Protein (H00002206-P01) (0)

There are no publications for Fc epsilon RI beta/MS4A2 Recombinant Protein (H00002206-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI beta/MS4A2 Recombinant Protein (H00002206-P01) (0)

There are no reviews for Fc epsilon RI beta/MS4A2 Recombinant Protein (H00002206-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fc epsilon RI beta/MS4A2 Recombinant Protein (H00002206-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fc epsilon RI beta/MS4A2 Products

Research Areas for Fc epsilon RI beta/MS4A2 Recombinant Protein (H00002206-P01)

Find related products by research area.

Blogs on Fc epsilon RI beta/MS4A2

There are no specific blogs for Fc epsilon RI beta/MS4A2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fc epsilon RI beta/MS4A2 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MS4A2