Novus Biologicals products are now on bio-techne.com

EFS Recombinant Protein Antigen

Name: EFS Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-31993PEP
Price: 279 USD

Images

There are currently no images for EFS Protein (NBP2-31993PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EFS Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EFS. Source: E. coli Amino Acid Sequence: IYKIPRASGTQLAAPRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGREPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALAS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	EFS
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31993. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EFS Recombinant Protein Antigen

CAS3
CASS3Cas scaffolding protein family member 3
EFS1
EFS2
embryonal Fyn-associated substrate
HEFS
signal transduction protein (SH3 containing)
SIN

Background

EFS (Embryonal Fyn-associated substrate) is a 561 amino acid docking protein. It contains an SH3 domain, which is known to be important in intracellular signal transduction. It helps play a role in coordinating tyrosine-kinase-based signal transduction related to cell adhesion. It may play a role in metastatic colorectal cancer, ovarian carcinoma, alzheimer's disease, prostate cancer, myotonic dystrophy, lung cancer, breast cancer, crohn's disease, gastric adenocarcinoma and multiple myeloma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MID1 Antibody -
BSA Free

NBP3-05061

Species: Hu, Mu

Applications: ICC/IF, WB

Substance P
Antibody (266815)

MAB4375

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt

Applications: IHC

VIP Antibody
(OTI1E8)

NBP2-46349

Species: Hu

Applications: IHC, WB

nNOS Antibody

NB100-858

(1 Review)

(15 Publications)

Species: Gp, Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB

Recombinant Human
PRH2 GST (N-Term) Pro ...

H00005555-P01

Species: Hu

Applications: ELISA, AP, PA, PAGE, WB

Progesterone
R/NR3C3 Antibody [Unc ...

AF5415

Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]

Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]

(2 Publications)

Species: Hu

Applications: ICC, IHC, Simple Western, WB

iNOS Antibody -
BSA Free

NB300-605

(3 Reviews)

(130 Publications)

Species: Hu, Mu, Po, Rt

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB

TMEM37 Antibody

NBP2-47602

Immunohistochemistry-Paraffin TMEM37 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Fucosyltransferase
2/FUT2

7770-GT

(2 Publications)

Species: Hu

Applications: EnzAct

SQLE Antibody -
Azide and BSA Free

NBP2-93808

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

p130Cas/BCAR1
Antibody (OTI1A9)

NBP2-00532

(1 Publication)

Species: Ca, Hu, Pm, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CD34 Antibody
[Unconjugated]

AF4117

(3 Reviews)

(37 Publications)

Species: Rt

Applications: IHC, WB

TFF2 Antibody
(366508) [Unconjugate

MAB4077

(1 Publication)

Species: Hu

Applications: IHC, WB

Procalcitonin
Antibody (44D9)

NB120-14817

(1 Review)

(11 Publications)

Species: Hu, Rt

Applications: ICC/IF, IHC, S-ELISA, WB

Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...

MAB812

(4 Publications)

Species: Hu

Applications: CyTOF-ready, Flow

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

GADD153/CHOP
Antibody (9C8)

NB600-1335

Flow Cytometry GADD153/CHOP Antibody (9C8)

Immunohistochemistry-Paraffin GADD153/CHOP Antibody (9C8)

(3 Reviews)

(45 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

n-Myc Antibody
(NMYC-1) - BSA Free

NB200-109

Immunocytochemistry/ Immunofluorescence n-Myc Antibody (NMYC-1) - BSA Free

(6 Publications)

Species: Hu, Mu

Applications: ChIP, ChIP, CyTOF-ready, Flow, GS, ICC/IF, IP, WB

NEDD9/CASL/HEF1
Antibody (2G9) - (82- ...

NB100-1699

Western Blot NEDD9/CASL/HEF1 Antibody (2G9) - (82-398 aa)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

EFS Recombinant
Protein Antigen

NBP2-31993PEP

Species: Hu

Applications: AC

Publications for EFS Protein (NBP2-31993PEP) (0)

There are no publications for EFS Protein (NBP2-31993PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EFS Protein (NBP2-31993PEP) (0)

There are no reviews for EFS Protein (NBP2-31993PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EFS Protein (NBP2-31993PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EFS Products

Research Areas for EFS Protein (NBP2-31993PEP)

Find related products by research area.

Signal Transduction

Blogs on EFS

There are no specific blogs for EFS, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.

iNOS Antibody - BSA Free
NB300-605

GADD153/CHOP Antibody (9C8)
NB600-1335

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our EFS Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

EFS

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

EFS Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

EFS Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for EFS Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for EFS Protein (NBP2-31993PEP) (0)

Reviews for EFS Protein (NBP2-31993PEP) (0)

FAQs for EFS Protein (NBP2-31993PEP) (0)

Additional EFS Products

Research Areas for EFS Protein (NBP2-31993PEP)

Blogs on EFS

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics