Home » EDC3 » EDC3 Proteins » EDC3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

EDC3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for EDC3 Protein (NBP2-30696PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

EDC3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EDC3.

Source: E. coli

Amino Acid Sequence: LDCPENVFLRDQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVGINYHSPFGCKFVIPL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EDC3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30696.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for EDC3 Recombinant Protein Antigen

  • enhancer of mRNA decapping 3 homolog (S. cerevisiae)
  • enhancer of mRNA-decapping protein 3
  • FLJ21128
  • FLJ31777
  • hYjeF_N2
  • hYjeF_N2-15q23
  • LSM16 homolog (EDC3, S. cerevisiae)
  • LSM16 homolog
  • LSM16
  • YJDC
  • yjeF domain containing
  • YjeF domain-containing protein 1
  • YjeF N-terminal domain-containing protein 2
  • yjeF_N2
  • YJEFN2yjeF domain containing (E.coli)

Background

EDC3, also known as Enhancer of mRNA-decapping protein 3, is a 508 amino acid that is 56 kDa, located in the cytoplasm and expressed in theca and granulosa cells in ovary, Sertoli cells in testis (at protein level), brain and mammary glands; may play a role in mRNA decapping in the process of mRNA degradation, and also in spermiogenesis and oogenesis. Disease research is currently being studied with relation to central nervous system origin vertigo, patellofemoral pain syndrome and hordeolum. Interactions with the EDC3 protein have been shown to involve YWHAG, YWHAB, ZFP36, SFN, DDX6, YWHAZ, DCP2, UPF1, DCP1B and KBTBD7 in n exonucleolytic nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, gene expression, and mRNA metabolic process pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DCP2 Antibody
NBP2-16109
Western Blot DCP2 Antibody
Immunocytochemistry/ Immunofluorescence DCP2 Antibody
Immunohistochemistry-Paraffin DCP2 Antibody
(3 Publications)
Species: Dr, Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, ISH, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DCP1B Antibody
NBP1-82018
Western Blot DCP1B Antibody
Immunohistochemistry-Paraffin DCP1B Antibody
Immunocytochemistry/ Immunofluorescence DCP1B Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DDX6 Antibody
NB200-191
Immunoprecipitation DDX6 Antibody
Immunohistochemistry-Paraffin DDX6 Antibody
Immunocytochemistry/ Immunofluorescence DDX6 Antibody
(1 Review)
(44 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
EDC4 Antibody
NBP2-13944
Western Blot EDC4 Antibody
Immunohistochemistry-Paraffin EDC4 Antibody
Immunohistochemistry-Paraffin EDC4 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
APOA1BP Antibody
NBP2-30626
Immunocytochemistry/ Immunofluorescence APOA1BP Antibody
Western Blot APOA1BP Antibody
Immunohistochemistry-Paraffin APOA1BP Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Xrn1 Antibody
NB500-191
Western Blot Xrn1 Antibody
Immunoprecipitation Xrn1 Antibody
(8 Publications)
Species: Hu, Mu
Applications: IP, WB
SLC36A1 Antibody
NBP2-80524
SLC36A1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
APPBP2 Antibody -
BSA Free
NBP2-81781
Western Blot APPBP2 Antibody - BSA Free
Immunohistochemistry-Paraffin APPBP2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence APPBP2 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Dcp1a Antibody
(3G4)
H00055802-M06
Immunocytochemistry/ Immunofluorescence Dcp1a Antibody (3G4)
Immunocytochemistry/ Immunofluorescence Dcp1a Antibody (3G4)
Immunocytochemistry/ Immunofluorescence Dcp1a Antibody (3G4)
(1 Review)
(54 Publications)
Species: Hu, I, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IP, PLA, WB
YSK4 Antibody (2A4)
H00080122-M01
Immunocytochemistry/ Immunofluorescence YSK4 Antibody (2A4)
Immunocytochemistry/ Immunofluorescence YSK4 Antibody (2A4)
ELISA YSK4 Antibody (2A4)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF
Apolipoprotein
A-I/ApoA1 Antibody - ...
NBP2-52979
Flow Cytometry Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Western Blot Apolipoprotein A-I/ApoA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Apolipoprotein A-I/ApoA1 Antibody - BSA Free
(1 Review)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HMGA1 Antibody
(5J0E6)
NBP3-16379
Immunohistochemistry-Paraffin HMGA1 Antibody (5J0E6)
Immunohistochemistry-Paraffin HMGA1 Antibody (5J0E6)
Western Blot HMGA1 Antibody (5J0E6)
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
TTP Antibody
(OTI8B5)
NBP2-02105
Flow Cytometry TTP Antibody (OTI8B5)
Western Blot TTP Antibody (OTI8B5)
Immunohistochemistry-Paraffin TTP Antibody (OTI8B5)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
eIF4ENIF1 Antibody
H00056478-B01P
Immunocytochemistry/ Immunofluorescence eIF4ENIF1 Antibody
Western Blot eIF4ENIF1 Antibody
Western Blot eIF4ENIF1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IP, WB
EDC3 Recombinant
Protein Antigen
NBP2-30696PEP
EDC3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for EDC3 Protein (NBP2-30696PEP) (0)

There are no publications for EDC3 Protein (NBP2-30696PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EDC3 Protein (NBP2-30696PEP) (0)

There are no reviews for EDC3 Protein (NBP2-30696PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for EDC3 Protein (NBP2-30696PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional EDC3 Products

Blogs on EDC3

There are no specific blogs for EDC3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: Dcp1a Antibody (3G4) [H00055802-M06] - The MIWI2/MAEL granule is a modified P-body. Localization of P-bodies in gonocytes. Cross section seminiferous tubule from wild-type testis (E18.5) were probed with antibodies against DCP1a. Image collected and cropped by CiteAb from the following publication (https://dx.plos.org/10.1371/journal.pgen.1000764), licensed under a CC-BY license.
Dcp1a Antibody (3G4)
H00055802-M06-50ug
Immunoprecipitation: DDX6 Antibody [NB200-191] - Detection of human DDX6 by Western Blot and Immunoprecipitation. Samples: Whole cell lysate (15 and 50 ug) from HeLa cells. Antibodies: Affinity purified rabbit anti-DDX6 antibody NB200-191 used at 0.04 ug/ml for WB (A and B) and at 3 ug/mg lysate for IP. DDX6 was also immunoprecipitated using rabbit anti-DDX6 antibody NB200-192, but not with 'DDX6 Ab', which is to another epitope from DDX6. Normal rabbit IgG was used as a negative control. Detection: Chemiluminescence with an exposure time of 1 second (A & B).
DDX6 Antibody
NB200-191

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our EDC3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EDC3