![ELISA: Dynein light chain 2 cytoplasmic Antibody (1G7) [H00140735-M04] - Detection limit for recombinant GST tagged DYNLL2 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Dynein-light-chain-2-cytoplasmic-Antibody-1G7-ELISA-H00140735-M04-img0002.jpg "ELISA: Dynein light chain 2 cytoplasmic Antibody (1G7) [H00140735-M04] - Detection limit for recombinant GST tagged DYNLL2 is 0.3 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 1G7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | DYNLL2 (NP_542408, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH |
| Specificity | Reacts with dynein, light chain, LC8-type 2. |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | DYNLL2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is reactive against recombinant protein in western blot and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
| Publication using H00140735-M04 | Applications | Species |
|---|---|---|
| Gogada R, Yadav N, Liu J et al. BIM, a proapoptotic protein, upregulated via transcription factor E2F1-dependent mechanism, functions as a prosurvival molecule in cancer J Biol Chem 2012-11-14 [PMID: 23152504] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Dynein light chain 2 cytoplasmic Antibody (H00140735-M04)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
