![Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Analysis in human adrenal gland and testis tissues. Corresponding Dopamine beta-Hydroxylase RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Dopamine-beta-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-55677-img0011.jpg "Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Analysis in human adrenal gland and testis tissues. Corresponding Dopamine beta-Hydroxylase RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DBH |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Dopamine beta-Hydroxylase Antibody (NBP2-55677)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DBH |
![Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human adrenal gland, kidney, lower gastrointestinal and testis using Anti-Dopamine beta-Hydroxylase antibody NBP2-55677 (A) shows similar protein distribution across tissues to independent antibody NBP2-57836 (B).](http://images.novusbio.com/fullsize/Dopamine-beta-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-55677-img0015.jpg "Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human adrenal gland, kidney, lower gastrointestinal and testis using Anti-Dopamine beta-Hydroxylase antibody NBP2-55677 (A) shows similar protein distribution across tissues to independent antibody NBP2-57836 (B).")
![Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/Dopamine-beta-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-55677-img0017.jpg "Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Dopamine-beta-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-55677-img0012.jpg "Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human colon shows strong cytoplasmic positivity in peripheral ganglion.](http://images.novusbio.com/fullsize/Dopamine-beta-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-55677-img0014.jpg "Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human colon shows strong cytoplasmic positivity in peripheral ganglion.")
![Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human kidney shows no weak positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/Dopamine-beta-Hydroxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-55677-img0016.jpg "Immunohistochemistry-Paraffin: Dopamine beta-Hydroxylase Antibody [NBP2-55677] - Staining of human kidney shows no weak positivity in cells in tubules as expected.")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")