![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cerebral cortex, heart muscle, kidney and pancreas using Anti-CS antibody NBP2-13878 (A) shows similar protein distribution across tissues to independent antibody NBP2-13877 (B).](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0011.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cerebral cortex, heart muscle, kidney and pancreas using Anti-CS antibody NBP2-13878 (A) shows similar protein distribution across tissues to independent antibody NBP2-13877 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: ADLIPKEQARIKTFRQQHGKTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGFSIPECQKLLPKAKGGEEPLPEGLFWLLVTGHIPTEEQVSWL |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CS Citrate Synthase Antibody (NBP2-13878)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CS |
![Western Blot: CS Citrate Synthase Antibody [NBP2-13878] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Western-Blot-NBP2-13878-img0005.jpg "Western Blot: CS Citrate Synthase Antibody [NBP2-13878] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13878-img0007.jpg "Immunocytochemistry/Immunofluorescence: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cererbellum shows moderate to strong cytoplasmic positivity in purkinje cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0017.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cererbellum shows moderate to strong cytoplasmic positivity in purkinje cells.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0008.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human heart muscle shows high expression.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human kidney.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0012.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0013.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0014.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0016.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human pancreas.](http://images.novusbio.com/fullsize/CS-Citrate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-13878-img0015.jpg "Immunohistochemistry-Paraffin: CS Citrate Synthase Antibody [NBP2-13878] - Staining of human pancreas.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")