Corneodesmosin Antibody (6F11) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
CDSN (NP_001255, 306 a.a. ~ 355 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP |
Specificity |
CDSN - corneodesmosin |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CDSN |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Publications |
|
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Corneodesmosin Antibody (6F11)
Background
This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IP
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Gt, Gp, Hu, Mu, Po, Rb, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu, Mu
Applications: IHC, IP, WB
Publications for Corneodesmosin Antibody (H00001041-M01)(6)
Showing Publications 1 -
6 of 6.
Publications using H00001041-M01 |
Applications |
Species |
Janan M, Arti N, Mor P et al. Phenotypic suppression of acral peeling skin syndrome in a patient with autosomal recessive congenital ichthyosis. Exp Dermatol. 2020-07-20 [PMID: 32618001] |
|
|
Janan M, Ofer S, Liron M et al. Loss-of-function variants in SERPINA12 underlie autosomal recessive palmoplantar keratoderma. J Invest Dermatol. 2020-04-02 [PMID: 32247861] |
|
|
Peled A, Samuelov L, Sarig O et al. Treatment of hereditary hypotrichosis simplex of the scalp with topical gentamicin. Br J Dermatol. 2019-12-26 [PMID: 31746457] |
|
|
Abdayem R, Formanek F, Minondo AM et al. Cell surface glycans in the human stratum corneum: distribution and depth -related changes. Exp Dermatol 2016-05-10 [PMID: 27193164] |
|
|
Riethmuller C, McAleer MA, Koppes SA et al. Filaggrin breakdown products determine corneocyte conformation in patients with atopic dermatitis. Journal of Allergy and Clinical Immunology. 2015-06-01 [PMID: 26071937] |
|
|
Fluhr JW, Lachmann N, Baudouin C et al. Development and organization of human stratum corneum after birth: electron microscopy isotropy score and immunocytochemical corneocyte labelling as epidermal maturation's markers in infancy. Br J Dermatol. 2014-10-03 [PMID: 24506732] |
|
|
Reviews for Corneodesmosin Antibody (H00001041-M01) (0)
There are no reviews for Corneodesmosin Antibody (H00001041-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Corneodesmosin Antibody (H00001041-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Corneodesmosin Products
Blogs on Corneodesmosin