![Western Blot: Contactin-4 Antibody [NBP2-92013] - Analysis of extracts of various cell lines, using Contactin-4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.](http://images.novusbio.com/fullsize/Contactin-4-Antibody-Western-Blot-NBP2-92013-img0001.jpg "Western Blot: Contactin-4 Antibody [NBP2-92013] - Analysis of extracts of various cell lines, using Contactin-4 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 448-697 of human CNTN4 (NP_001193885.1). VGVFNNKGEGPFSPTTVVYSAEEEPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRKPPPSQPPGNIIWNSSDSKIILNWDQVKALDNESEVKGYKVLYRWNRQSSTSVIETNKTSVELSLPFDEDYIIEIKPFSDGGDGSSSEQIRIPKISNAYARGSGASTSNACTLSAISTIMISLTARSSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CNTN4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Contactin-4 Antibody (NBP2-92013)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CNTN4 |
![Immunohistochemistry Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-2_AF4439_Immunohistochemistry_10516.jpg)
![Simple Western Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin2_AF4439_Simple_Western_17121.jpg)
![Western Blot Contactin-2/TAG1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-2_AF4439_Western_Blot_9589.jpg)
![Western Blot Contactin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-3_AF5539_Western_Blot_5751.jpg)
![Immunocytochemistry Contactin-3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-3_AF5539_Immunocytochemistry_11752.jpg)
![Western Blot Contactin-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-6_AF5890_Western_Blot_10481.jpg)
![Immunohistochemistry Contactin-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-6_AF5890_Immunohistochemistry_10507.jpg)
![Simple Western Contactin-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin6_AF5890_Simple_Western_17653.jpg)
![Western Blot Contactin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-1_AF904_Western_Blot_5941.jpg)
![Immunohistochemistry Contactin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-1_AF904_Immunohistochemistry_6914.jpg)
![Neutralization Contactin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Contactin-1_AF904_Block_Neutralize_8982.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CHL1_AF2147_Immunohistochemistry_17310.jpg)
![Simple Western CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CHL1_AF2147_Simple_Western_18656.jpg)
![Western Blot CHL-1/L1CAM-2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2147_mouse-chl-1-l1cam-2-affinity-purified-polyclonal-ab-412024124025.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")