I need a Chromogranin C antibody to run some Western Blots on equine samples. Can you help me choose? I see two candidates on the website NBP1-56985 and NBP1-91628

Name: Chromogranin C Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-62693PEP
Price: 279 USD

Question

Accepted Answer

The two products for chromogranin C that are validated for equine samples on our site (NBP1-56985 and NBP1-91628) have been guaranteed based on homology. Below is the percent homology shared between the antibody immunogen and the horse protein sequence. NBP1-56985: immunogen is 100% homologous and NBP1-91628: immunogen is 92% homologous Based on this homology, NBP1-56985 will be your best choice. Since both products are covered by our guarantee, if you purchase either for use with your equine samples, and you are not able to detect the correct band, just contact us and we will see if there is any suggestion we can offer. If not, we can at that time offer a refund or replacement for your order.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	AC

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCG2. Source: E. coli Amino Acid Sequence: NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	SCG2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	Antibody Competition 10-100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62693. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Chromogranin C Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Chromogranin C Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Chromogranin C Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Chromogranin C Recombinant Protein Antigen (NBP2-62693PEP) (0)

Reviews for Chromogranin C Recombinant Protein Antigen (NBP2-62693PEP) (0)

FAQs for Chromogranin C Recombinant Protein Antigen (NBP2-62693PEP). (Showing 1 - 1 of 1 FAQ).

Additional Chromogranin C Products

Research Areas for Chromogranin C Recombinant Protein Antigen (NBP2-62693PEP)

Blogs on Chromogranin C

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics