Do you have an antibody for CD1d that works well on formalin fixed paraffin embedded tissue (specifically for liver tissue)?

Name: CD1d Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-57561PEP
Price: 279 USD

Question

Accepted Answer

We do have a CD1d antibody that has been verified in paraffin-embedded tissue sections. The catalog number is NBP1-43461.

Reactivity	HuSpecies Glossary
Applications	AC

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD1d. Source: E. coli Amino Acid Sequence: AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	CD1D
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57561. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

CD1d Recombinant Protein Antigen