![Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Analysis in human placenta and tonsil tissues. Corresponding PVR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/CD155-PVR-Antibody-Immunohistochemistry-Paraffin-NBP1-88131-img0013.jpg "Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Analysis in human placenta and tonsil tissues. Corresponding PVR RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PVR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88131 | Applications | Species |
|---|---|---|
| Peng YP, Xi CH, Zhu Y et al. Altered expression of CD226 and CD96 on natural killer cells in patients with pancreatic cancer. Oncotarget. 2016-10-11 [PMID: 27626490] (IF/IHC, Human) | IF/IHC | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CD155/PVR Antibody (NBP1-88131)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PVR |
![Western Blot: CD155/PVR Antibody [NBP1-88131] - Analysis in human cell lines A-431 and MCF-7 using Anti-PVR antibody. Corresponding PVR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/CD155-PVR-Antibody-Western-Blot-NBP1-88131-img0008.jpg "Western Blot: CD155/PVR Antibody [NBP1-88131] - Analysis in human cell lines A-431 and MCF-7 using Anti-PVR antibody. Corresponding PVR RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human tonsil shows no positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/CD155-PVR-Antibody-Immunohistochemistry-Paraffin-NBP1-88131-img0017.jpg "Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human tonsil shows no positivity in lymphoid cells as expected.")
![Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CD155-PVR-Antibody-Immunohistochemistry-Paraffin-NBP1-88131-img0014.jpg "Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human prostate shows weak to moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CD155-PVR-Antibody-Immunohistochemistry-Paraffin-NBP1-88131-img0015.jpg "Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human prostate shows weak to moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human stomach shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/CD155-PVR-Antibody-Immunohistochemistry-Paraffin-NBP1-88131-img0016.jpg "Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human stomach shows moderate membranous positivity in glandular cells.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Flow Cytometry DNAM-1/CD226 Antibody (102511) [Unconjugated]](https://images.novusbio.com/images2/DNAM1_MAB666_Flow_Cytometry_19202.jpg)
![Neutralization DNAM-1/CD226 Antibody (102511) [Unconjugated]](https://images.novusbio.com/images/antibody/mab666_human-dnam-1-cd226-mab-clone-102511-neutralization-59202414937.jpg)
![Immunocytochemistry Nectin-2/CD112 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nectin2_AF2229_Immunocytochemistry__Immunofluorescence_21146.jpg)
![Immunohistochemistry Nectin-2/CD112 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nectin2_AF2229_Immunohistochemistry_21147.jpg)
![Simple Western Nectin-2/CD112 Antibody [Unconjugated]](https://images.novusbio.com/images2/Nectin2_AF2229_Simple_Western_21749.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")