![Immunocytochemistry/Immunofluorescence: CBS Antibody [NBP1-83255] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CBS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83255-img0011.jpg "Immunocytochemistry/Immunofluorescence: CBS Antibody [NBP1-83255] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & vesicles. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIGAPHR |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CBS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Theoretical MW | 61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control |
|
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CBS Antibody (NBP1-83255)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/CBS-Antibody-Immunohistochemistry-Paraffin-NBP1-83255-img0010.jpg "Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/CBS-Antibody-Immunohistochemistry-Paraffin-NBP1-83255-img0007.jpg "Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/CBS-Antibody-Immunohistochemistry-Paraffin-NBP1-83255-img0008.jpg "Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer.](http://images.novusbio.com/fullsize/CBS-Antibody-Immunohistochemistry-Paraffin-NBP1-83255-img0009.jpg "Immunohistochemistry-Paraffin: CBS Antibody [NBP1-83255] - Staining of human cerebellum shows moderate cytoplasmic positivity in a subset of cells in granular layer, as well as in neuropil of molecular layer.")
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")