Calcineurin A Recombinant Protein Antigen

Images

 
There are currently no images for Calcineurin A Protein (NBP1-88218PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Calcineurin A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP3CA.

Source: E. coli

Amino Acid Sequence: SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP3CA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88218.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Calcineurin A Recombinant Protein Antigen

  • calcineurin A alpha
  • Calcineurin A
  • Calmodulin-dependent calcineurin A subunit alpha isoform
  • CALN
  • CALNA
  • CALNAcatalytic subunit, alpha isoform
  • CAM-PRP catalytic subunit
  • CNA
  • CNA1
  • CNA1CALNA1
  • EC 3.1.3.16
  • PP2B
  • PP3CA
  • PPP2B
  • PPP2BCCN1
  • PPP3CA
  • protein phosphatase 2B, catalytic subunit, alpha isoform
  • protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform(calcineurin A alpha)
  • protein phosphatase 3, catalytic subunit, alpha isozyme
  • serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform

Background

Calcineurin, a major soluble calmodulin binding protein in the brain, a Ca2+/calmodulin dependent serine/threonine protein phosphatase, with a relatively narrow substrate specificity. This metalloenzyme, also known as phosphatase 2B, is a heterodimer composed of a calmodulin binding, catalytic alpha subunit 61 kDa, calcineurin A) and calcium binding beta subunit (18 kDa, calcineurin B). The Ca2+ binding subunit, calcineurin B, is immunologically conserved from yeast to mammals. The presence of 2 different calcineurin B isoforms (beta 1 and beta 2) has been reported in rat testis. The catalytic subunit of calcineurin, calcineurin A, isolated from different tissues or different organisms, exhibits some immunological heterogeneity. Further, there are at least 2 isoforms of calcineurin A in bovine brain (alpha 1 and alpha 2, 61 and 59 kDa, respectively).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4055
Species: Mu
Applications: IHC, Simple Western, WB
AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF1348
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP3-32848
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93612
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
AF1680
Species: Mu
Applications: IHC, WB
DVE00
Species: Hu
Applications: ELISA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
202-IL
Species: Hu
Applications: BA
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-88218PEP
Species: Hu
Applications: AC

Publications for Calcineurin A Protein (NBP1-88218PEP) (0)

There are no publications for Calcineurin A Protein (NBP1-88218PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcineurin A Protein (NBP1-88218PEP) (0)

There are no reviews for Calcineurin A Protein (NBP1-88218PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Calcineurin A Protein (NBP1-88218PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Calcineurin A Products

Research Areas for Calcineurin A Protein (NBP1-88218PEP)

Find related products by research area.

Blogs on Calcineurin A.

The role of HIF-1 Alpha signaling in the retina under hypoxic conditions
Hypoxia inducible factor 1 (HIF-1) is a protein that plays an essential role in hypoxia, or low levels of cellular oxygen. HIF-1 is a heterodimeric protein that consists of a constitutively expressed beta subunit and oxygen related alpha subunit.  ...  Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Calcineurin A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3CA