Reactivity | Hu, Rt, PoSpecies Glossary |
Applications | WB, ELISA, ICC/IF, IHC |
Clone | 2G8 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen | PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP |
Specificity | PPP3CA (2G8) |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | PPP3CA |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | IgG purified |
Publications using H00005530-M03 | Applications | Species |
---|---|---|
Totzeck A, Boengler K, van de Sand A et al. No impact of protein phosphatases on connexin 43 phosphorylation in ischemic preconditioning. Am J Physiol Heart Circ Physiol. 2008-10-03 [PMID: 18835920] | ||
Mardjiati S, Wulan M, Laswati H, Hadi U, et al. Physical Exercise in Clinical Stage IIhuman Immunodeficiency Virus Infection Patients’ Increasesskeletal Muscle MAss Through the Increasing of Myogenic Regulatory Factors Expression Indian Journal of Forensic Medicine & Toxicology 2021-09-08 |
Secondary Antibodies |
Isotype Controls |
Research Areas for Calcineurin A Antibody (H00005530-M03)Find related products by research area.
|
The role of HIF-1 Alpha signaling in the retina under hypoxic conditions Hypoxia inducible factor 1 (HIF-1) is a protein that plays an essential role in hypoxia, or low levels of cellular oxygen. HIF-1 is a heterodimeric protein that consists of a constitutively expressed beta subunit and oxygen related alpha subunit. ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.